KEGG   Plasmodium knowlesi: PKH_143620Help
Entry
PKH_143620        CDS       T01094                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
pkn  Plasmodium knowlesi
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PKH_143620
Exosome [BR:pkn04147]
 Exosomal proteins
  Proteins found in most exosomes
   PKH_143620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
14:1617957..1623713
Genome map
AA seq 1918 aa AA seqDB search
MNPNNPLSVAVADSLSAYDIQNESFRLGNVSIEGDKYICVKENVNENTQVVVINLQNKIS
TRKYMKAESVIIHPNDPILALRGTIKNVNTIFLQVFNIETKEKICSLNLNEYMNYWKWIN
NDTIAIVCEKNVYHWNIDIHNSKKHKENYTLTKVFEKAQVFIDNNSQILYYGTDKDMKWC
ILCGISTQDQGKSIDGYMQLYSCDKKLHQTIEGFIGCFGSFIFDNWEMKPLFCFVEKKKN
SSISRIHLMDIYTNKTETGTMPYKIVKEINLINEHISDFPIYMSLNTLQGVIYIVTKCSY
VYIFDEGTLTQLVKEKISEDNIFICCDRKNGEGIYAVNKKGKIYYITINYVNLINHIKLS
NFESKDKIIQNLCVKYGYPGCDYISSYKKCINEMDFKKASKLICLLKNTKMYEEYSSSIA
EAVLIMTRKNVDIRIIPPLRTQQVLNSFKSMKNASGQLSPLLLYFSVLLEYDKLNTYESV
ELVKPVVLQKKKEYLEKWIKDDKLTCSEELGDLVKVLDLRLALNIYLRCGAHNKIISTYC
LLNMFNNVLSYLNNFKNFSFDFVSIFIVIVNYESQYSNEKDGSSTMTDISGSSKNEAMDF
FNDSSNSTNDSRQGKGSNNEVAVQYVKFLCENNIPFDINNIIDYLLSKKKLQEATSILLD
FLKDNKPEHKNLQTKLFEFNLYNNVQVAETLFQMDIFTYYDKNRIAYLCEEKGLYQRALE
NYTNLNDIKRVITKSSCFQKNTNMNHNMEDSLPNRAISIDWIKKYFSTLSDSVCQDILFD
FMKGNKINMEVVISICVQYYNKIGIKKIINKFEENKNYEGIFYFVSSILTHLPNLTSKST
DHLSYGNMNDDASSILLASDIGSQYSNAENSSNLKIEDVHFIMFKYIEACVKINNIQELD
RICKDKNAMYNPEQIKNFLKDCKLSDPRPLIYVCDIHNYIEELAEYLYKNSLLKYIEVYV
IKVNPNNAHKVIGVLLDLDASEDFLLNLLNNIKNISNIGNLIEIAEKRNRLKLLLPWLES
RSNEGYENIELHNALAKIYIDLNKDPENFLKNNNFYDKKLIGKYCEDLDPHLAYTVYEKS
NGECDEELIHITSKNGLFKLQAKYLVSRQSMELWIKVLDESNKYRKNVIDQVIGSTLIES
NNAEEITVTVKAFIEKKLSSELIELLEKIVLHNSEFSDNKNLQNLLILTAIKSDSKKVME
YINRLDNFSAPQIASVAYQYKLREEAFVIYKKFNYYKLAISVLLDKILHVNHKSAYPCEF
SGASSSVYNDSDDYVKQLGEGGSYGYQDRADNLFSGSNDVSGSLGESDSHDAQEFLLDAK
LYEDDLNRAIEYAQKCNNNDVWFILGKAQLKINKIIDAIDSFVKSNNPEAYKEVITKCKE
NNFYEHLITYLNTLRDQNLLKDVLVDSELLYAYAKLKKTTEMTKFIGCTNSANLQLIGDR
LFKEQEYEVAKILYSNIPNNQKLTFCYLKLKEYSLAIEAAKKAKSLKTWKEVNFICVKYK
QLKHAHTAGLQLIMHADHLDEIIKIYEKKKYINELMSLLENGLNNERAHVGIYTELGILY
AKYKPEKLMEYIRNYSNKMNTRKLIDVCQNEYLLKEAVYLYISYDEYNLAVDTIIKHSPT
AYTPDTFMQVIHKVTNSDIIHKVIDFYIEEHPLNLYNLLKILENKIDNNRLVQTLKKSNN
LPLIQKYLEDIQGQNITAVNETLNEIYLQNDDYISLRNSIDEYDNFNQTNLINKLENHKL
PEMRRIAALLYKKNKKYKEAINLSKKEEQYKDAIEIARVSKNNSYVEDLINFFIEIKNKE
ALCACLIVCYDILKPDYILEIVWMSGYKDQAMLYFIQVISDYTNQIDVMKKQIEDMQKEK
KMNKSAPNDFAANSMPGQFNYSLNNHLSIMPPQNTYMSSSSQYDKYDKYDMFNNNSHF
NT seq 5757 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccaacaatcccttatctgtcgcagtggcagatagtctgtccgcttatgacatc
cagaatgagtcgtttcgtctaggcaatgtatccatcgaaggagacaaatatatatgcgtt
aaagaaaatgtgaacgagaacacccaagtggtggttataaacttgcaaaataagataagc
acgcgcaagtatatgaaagcagagagtgtcattattcaccccaatgaccccatattagca
ttgagaggcacgataaaaaatgtaaacacgatattcttacaagtttttaatatagaaacg
aaggaaaaaatatgctccctaaatttaaatgagtatatgaattactggaagtggataaat
aatgatacaattgccattgtctgtgagaaaaatgtataccactggaacatagacattcac
aatagtaagaagcataaggagaattacacgttgacgaaagttttcgagaaggcacaagtt
ttcattgacaacaattctcaaattttatattatggcacagataaggatatgaaatggtgc
attttgtgtgggatatctacgcaggatcaagggaaaagcatagatgggtatatgcaactt
tattcttgtgataagaagttgcaccaaacgattgaaggatttataggatgttttggatca
tttatatttgataattgggaaatgaaaccgctcttttgtttcgtcgaaaagaagaagaat
tcaagcatatcgagaatccacttgatggatatatacactaacaaaacggagaccggtacc
atgccatacaaaattgtcaaggaaattaatctgataaatgagcacattagtgattttcca
atttatatgagcctaaatactctgcaaggggtaatatatattgtgacaaagtgcagctat
gtgtacatatttgatgaaggcacactaacccaacttgtgaaggaaaaaattagcgaagat
aacattttcatctgctgtgatagaaaaaacggggaaggtatatacgctgtaaacaaaaaa
ggaaaaatttattacatcaccattaattacgtcaatttaataaaccatataaaattatcc
aactttgaaagtaaggataaaattatacaaaatttatgcgtaaaatatggatacccaggg
tgcgactacataagttcttataaaaaatgtattaacgaaatggattttaaaaaggcctcg
aaacttatatgcttgttgaagaacaccaaaatgtatgaggagtattccagctcaattgcc
gaagctgttttgattatgaccagaaagaatgtagacattagaattattcctcctttaaga
acacaacaagttttgaatagcttcaagtcgatgaagaatgcatcgggacaattatcccct
cttcttctgtacttttcagtgctcctcgaatatgacaaattgaacacatacgaatcggtc
gagttggtgaaacctgtcgttttgcaaaaaaaaaaggagtacctggaaaaatggataaag
gatgacaagttaacatgttcagaagaattgggagatttagtcaaagtattagatttgcga
ttagcgttgaatatttacctgcgctgtggagcgcacaataaaataatttccacctactgt
cttttgaacatgtttaataatgtcctaagctatttgaataattttaagaacttctccttc
gactttgtcagcatattcattgttattgtgaattacgaatctcagtacagtaacgagaaa
gacggaagttccaccatgactgatataagtggctcctcgaagaacgaagcgatggatttc
ttcaacgatagcagtaatagtacaaacgatagcagacagggaaaaggtagcaacaacgaa
gtggctgtgcagtatgtaaaatttctctgtgaaaataacatcccatttgatatcaacaat
attattgattatctgctgagtaagaagaagttacaagaagccacctccatactgttagat
tttctcaaagacaataaaccggaacataaaaatttacaaaccaaattgtttgaatttaat
ctttacaataatgtacaagtagcagaaactctattccaaatggatatttttacctactat
gataaaaacagaatagcctatttgtgtgaagagaaagggttatatcagagggccttggaa
aactacaccaatttgaatgacataaaaagggtcatcaccaaatcatcttgctttcaaaag
aacacaaatatgaatcacaacatggaggattctctccccaatagagctatttccatcgac
tggattaagaagtacttttctacgttaagcgactctgtgtgccaagatatactgtttgat
ttcatgaaggggaataaaataaatatggaggtcgtcatttcgatttgcgtccagtattat
aacaaaataggtattaagaaaattatcaacaaatttgaggaaaacaagaactacgaagga
attttctacttcgttagttctatcctgactcacttaccgaacttaactagcaaatcgacg
gaccacctatcctatggaaacatgaacgatgatgcgtcgtccatcctcttggcatctgac
atcggatcacagtacagcaacgcagaaaattcatccaacctgaaaatcgaagatgttcat
tttatcatgtttaaatatattgaggcgtgtgtcaagataaacaacatccaagagttagac
agaatttgtaaagacaaaaatgcaatgtacaatccagaacaaattaaaaacttcttaaag
gactgtaaattatccgacccccgtccactgatatacgtatgtgatatacataattatatt
gaagaactggccgaatatttatataaaaatagcttattaaaatatatagaagtgtatgtg
attaaggttaatccaaataatgctcacaaggtgatcggtgtactcctggacttggacgca
tcggaagacttcctcctaaatctgttgaacaatataaaaaatatttccaatataggaaat
ctaatcgaaatagcagaaaagaggaataggctaaaattattattaccatggctggaaagc
agatccaatgagggatatgaaaatattgaactacataacgctttggccaaaatatacata
gacttaaataaggatccagagaattttctgaagaataacaatttctatgataaaaaattg
ataggaaaatattgtgaagatctggacccgcatttagcctatactgtgtacgaaaaatcc
aacggagagtgcgacgaggagttaatccatataactagcaaaaatggcttattcaaactg
caagccaaatatttagtatctagacaatccatggaattgtggataaaggttttggacgaa
tctaacaagtacagaaagaacgtaattgatcaggtcattggttcgaccctgatcgaatct
aacaacgcagaagaaattaccgtaacggttaaagcctttattgagaaaaaactaagcagt
gaattaattgagttgttagaaaaaatcgttttacataacagcgaatttagtgataataag
aatttgcaaaacttactaattttgactgccattaaatcggattcaaagaaagtcatggag
tatataaaccgacttgataacttttctgctccgcaaattgcatccgttgcatatcaatat
aagctgagggaagaagcatttgttatttataaaaagttcaattactacaagttagccatc
tccgtgttgttagataaaatcctacatgtgaatcataaaagcgcctatccatgtgaattt
tccggagcgagttcttctgtgtacaacgatagtgatgattatgtaaagcagttgggagag
ggaggaagctacggctatcaagatcgagcggacaatttgttcagcggcagtaacgatgtg
agcggctcgctcggtgagtctgattcccacgacgcgcaggaatttctcctagatgcgaaa
ctctacgaggatgacctaaacagagctattgagtacgcacaaaagtgcaataacaatgat
gtgtggttcattctaggaaaagcgcaactaaaaataaacaaaattattgacgctattgac
agtttcgtaaaatcgaacaacccagaagcgtacaaagaagttataacaaagtgcaaggag
aataatttttacgagcatttaattacgtatctgaacacactgagggatcaaaatttgcta
aaggacgtgttggtagattcggaactactatatgcctatgcgaaattgaagaaaacaacc
gaaatgactaaatttattggctgtaccaattcagcaaacttgcaactaataggggataga
ttatttaaagaacaagagtatgaagtagccaaaatattgtacagtaacataccgaacaat
cagaagctaaccttctgttatttgaagctcaaggaatactcgctagccatagaagcagcg
aagaaggcgaagagtctgaaaacgtggaaagaagtaaactttatttgtgttaagtacaag
cagttgaagcatgcacacacggcagggctccaattaattatgcatgcggatcacctggac
gaaattatcaagatttatgaaaaaaaaaaatacataaacgagttaatgagtttactggaa
aatggactaaacaatgaaagagcacacgtaggaatttacactgagttaggtatcctctat
gccaagtacaaaccggagaaattaatggagtacataagaaattattcaaataaaatgaac
acaagaaaattaattgatgtttgccaaaatgaatacctattaaaagaggctgtttatttg
tacatatcatacgatgaatacaacttagcggtagataccattataaagcattctcctaca
gcctacacaccggacaccttcatgcaggtcattcataaagtcaccaacagcgatatcata
cacaaagtaattgatttctatatagaagagcacccattaaatttatataatttgttaaaa
atattggaaaacaaaattgataacaatagattagtacaaaccttaaagaaatcgaacaat
ttacctctcatacaaaaatatctggaagatatacaaggtcaaaatataactgctgtaaat
gaaacgctaaacgaaatttatttacaaaatgatgattacataagtttgaggaactcaatt
gatgaatatgataattttaaccaaaccaatttaatcaataaattggaaaatcacaaactt
ccagaaatgagaagaattgcagctctgctttataagaaaaataaaaaatataaagaagct
attaatctttcgaaaaaagaggaacagtataaggacgcaatcgaaattgcaagagtgtcc
aagaataattcctacgttgaagatttaataaactttttcatcgaaattaaaaataaagaa
gccttgtgcgcgtgcctcatcgtttgttatgatatactcaagccggactatatattagaa
attgtctggatgagtggatataaggaccaagccatgttatacttcattcaagttatcagc
gattataccaatcagatagatgtgatgaagaaacaaatcgaagacatgcagaaggagaag
aagatgaataaatctgcgccgaacgattttgcggccaactccatgcctgggcaattcaac
tactcgctgaataaccacttgtccatcatgcctcctcagaatacctacatgtccagcagt
tcccagtacgacaaatatgacaaatatgacatgtttaacaacaattcgcacttttga

DBGET integrated database retrieval system