KEGG   Plasmodium knowlesi: PKH_144060Help
Entry
PKH_144060        CDS       T01094                                 

Gene name
GTP-CH
Definition
gtp cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pkn  Plasmodium knowlesi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pkn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
14:1841687..1843042
Genome map
AA seq 451 aa AA seqDB search
MFKRGDLNEEKHSGLDSVHTYGQGSWMYREAPLKDGQSVGVSGNEDQREGWKCVLNTSPM
KTNLGLGLFRVKNGIENNGRGCNNCRDGDEHFSYTSQPTPSLINKDSELRYNGISISREM
EKMTDYQTNGEELSHLSEEASLGKGHQNNAGSSMEASPPCAIRMEEKRGAVNGLRRKVIK
RVEKKDQGGNSCDDSRNDRNLDDISSGHTNDSHNNNGNTNGCDPPPVRRKEPCGIDTPRE
SNEKAGTKKDEQIADISRSIKKILRSSKVPPKDILKKTGRRFSDTFLYLTKGYHMSVEKV
IKKSLYKRNYKNNSVIKISGIHIYSLCKHHLLPFEGECTIEYIPNKYIMGLSKFSRVIDI
FARRLQLQEDLTNDICNALGKYLKPKYLHVNLVARHLCINMRGVKEHDATTITNAYYEVK
NDTCVNHAGNGFTCPSFHNGNNPSREDIAPV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacgaggggacctcaatgaggaaaagcacagtggcctagatagcgttcacacg
tacggccagggaagttggatgtatagggaagcaccccttaaggatggtcagtcggtaggt
gtaagtgggaatgaagatcaacgagaggggtggaaatgcgtactgaatactagccctatg
aagacgaatttagggttagggttgttcagggtaaagaatggtattgaaaataatggcaga
ggatgcaataactgcagagatggggatgaacatttttcctacacaagtcagcctacgcct
agccttataaacaaggatagtgaattgcgttataatggaattagcatttcgagggaaatg
gaaaaaatgacagattatcagaccaatggagaggaattaagccatcttagtgaagaagcc
agtttggggaaaggccaccaaaacaacgcaggaagctccatggaggcatctcccccctgt
gctatccgtatggaggagaaaaggggcgcagtcaatggtttgcggaggaaagtgattaaa
agggtggagaagaaggatcaggggggaaacagctgtgatgacagtaggaatgacaggaat
ttggacgacatcagcagtggtcacacaaatgatagccacaacaataatggcaataccaat
gggtgtgaccccccccctgtgcggaggaaggaaccctgcggtatagacactccgcgagaa
agtaacgaaaaggctggaacaaaaaaggacgaacaaattgcagacataagcagaagcatt
aagaaaattttacgatcttctaaagtgcctccaaaagatatactaaaaaagacgggtaga
agattttcggataccttcctgtacttaacaaaagggtaccatatgagcgtagaaaaagtt
attaaaaaatccttgtacaaaaggaattacaaaaataactctgtcataaaaataagtggc
attcatatttactctttgtgcaagcatcatttgttgccattcgaaggagagtgcaccatc
gagtatatcccgaataaatatattatgggtctgtccaaattttccagggttatagatatt
tttgcgagaaggttacaactacaggaggatttaaccaatgacatttgtaatgctctgggg
aaatatttgaagccgaaatatctacatgtaaatcttgtggccagacatttatgcattaat
atgcgcggagtgaaggaacacgatgcgactactatcacgaatgcatactatgaggtaaaa
aatgatacttgtgtaaatcacgccgggaatggatttacgtgtccctccttccataatggg
aataatccatctcgagaagatatagcgcccgtgtga

DBGET integrated database retrieval system