KEGG   Plasmodium knowlesi: PKH_145800Help
Entry
PKH_145800        CDS       T01094                                 

Definition
3-hydroxyisobutyryl-coenzyme a hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pkn  Plasmodium knowlesi
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pkn01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pkn00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pkn00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:pkn00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
14:2607899..2609503
Genome map
AA seq 534 aa AA seqDB search
MQKLGSRLHLVEANRARRRFHNYVVNPERGGSLFCVPHFCTSHFSIKKGNPQREFKGASL
CERRQSNSFFSKARNNCSVDGKGRNEIFFERMEKKNSKTFHLTKQSVSSDKATTLDSAKG
GQVNEAEKEKNGKTSEEEAFLKNGNEDKMASRKGEKQNSDPHASVIDLELSELWSKKTLI
LNFKNSVFEIILNRPEKLNAINKDMINGLLNIVKSLNNDDRCHIIVIKSSNTACFCSGSD
VKDIVQNKEKGMQHLKQLYMYIHYLSKMKKPILCIWNGYAMGGGLGISMYAKFRIINKNA
IFAMPENKIGFFPDITCCYFFKKYFGRNIGLHLGLTSLRLNEVDLVNFKICSNYVEDVDE
LLNHIYKIGKTNQDEFDAELASVLDKYPPKVTTDTKPVLTEKLISNIDKYYSSATSLDDL
VSKLKKDQDDNPFCKETLDAINQNCYSSCNLWFEYFLYSYDKPLEEVLDNDFKITQHFLY
HTDTFEKGVTELLVKKNKSFKWSSVRDYGDLHVGPSVEDILTNSGVLSIRGEFT
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaggctcgcgactccatctggtagaagccaatcgtgcaagacggaggttt
cacaattatgtagtcaatccagagaggggtggctcccttttctgtgttccccatttttgt
acaagccatttttctataaaaaaaggcaacccacagagggagttcaaaggtgcgtccctc
tgcgaaaggagacaaagcaacagcttctttagcaaagcgagaaacaactgttccgtcgat
ggaaaaggaagaaatgaaatattttttgaaagaatggaaaaaaaaaatagcaaaactttt
catttgacgaaacaaagtgtgtccagtgataaagcaaccacactcgattctgcaaaaggg
ggacaagttaacgaagcggagaaggagaaaaatgggaaaacttcggaagaagaggcattc
ctcaagaatgggaatgaagacaaaatggccagtcgaaagggggaaaaacaaaatagtgac
ccgcacgcctcagtcatagacctagaactgtccgaactgtggtccaaaaaaactctcatt
ctaaatttcaaaaatagcgtattcgaaataattttaaacagaccagaaaagctgaacgca
attaacaaagacatgattaatggtttgttaaacattgtgaaaagcttaaacaacgatgat
aggtgtcacattattgtgataaaaagtagcaacacggcgtgcttctgctcaggttctgat
gtcaaggacattgtccaaaataaagaaaaagggatgcaacatttgaagcaactgtacatg
tacattcattatttatctaaaatgaaaaaacccatcttgtgcatatggaatggttatgct
atgggaggagggttagggatttctatgtatgcaaaatttaggataataaataagaacgcc
atatttgccatgccggaaaataaaattggcttcttccccgatatcacctgctgttacttt
tttaaaaaatattttggaagaaacattggtctccatctagggttgacttccctacggtta
aacgaagtcgatttagtcaactttaaaatttgtagcaactatgtggaagatgtggatgaa
ctgctgaaccatatttacaaaattgggaaaacaaaccaggatgagttcgatgcggaactt
gccagcgtcttagataagtacccgcccaaagtcactacagacacgaaaccggtacttact
gaaaaattaattagcaacatcgacaagtactacagttccgctactagtctagacgatctt
gttagcaagttgaaaaaggaccaggatgataaccccttttgcaaagagacccttgacgct
ataaaccagaactgctactccagttgcaatttatggtttgaatatttcctttacagttat
gataaacccttggaggaggtgctagacaacgattttaaaattacacagcatttcttgtat
cacacagataccttcgagaagggcgtaactgagctccttgtgaagaaaaataaatctttc
aagtggagctccgtgcgggattatggggatttgcatgtgggcccaagcgttgaagatatt
ctaacaaatagcggggtgttgtctatccggggagaattcacatga

DBGET integrated database retrieval system