KEGG   Plasmodium knowlesi: PKH_146130Help
Entry
PKH_146130        CDS       T01094                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pkn  Plasmodium knowlesi
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pkn00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PKH_146130
  Replication and repair
   03420 Nucleotide excision repair
    PKH_146130
Transcription machinery [BR:pkn03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PKH_146130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
14:complement(2750679..2753510)
Genome map
AA seq 943 aa AA seqDB search
MVRTRKNIENMEIYDYMKELSEKIWTYLFEDSLAHEAILQSLNELEQIIISRLLFIQQVV
SERAMRLWINPNSLKKLSECIKNLVEAKILVESETKKDNYNQYRINEKFRYTMLNKIYKN
REDRISIFNNNAKEQMEKEKNLLENNLYPTKEEILNYTHMRWNNLLHFIASPKLSHMNNY
MIYNNGISVEHRQEVYPPHATFPVNRNDDQGDPNRNKNVDKSTSSSYTPSKKGRKKNQTD
DEEYRPHGYFVHGGTAHNVVNYATGKEDEEDDQPVGDDDNGDDDNDDDSDERDNSDNGDH
NAEEANQIHGEKYETNPNEEVKYDQKYDQYGYYHKQSESVEAPPNGSAHNLNSLGPNQYY
THHSSKKRKKKKKKGVYAYKQNDLYYRSLQNEENGYLEEDNNDYSFFYSSAKKETFPSYT
PCDSLIEVLKRKNFILQDDANSNKTVNMSREAFSWFLKDIRSRIISLVLEYLLIVDDGYL
SNVAREISTKYKKANSNADASSGGGNSANAQDGESDYGTYTTYANNSTYPQRRGSNDLYS
GQIPTTHQQKVKNDGSGNPCYVTEENKEHKKSELYVKETLLLILSISQCTISHPIYLDNL
TKAQKEFINFGIHIGLFLKRAEDYVFVTPYALLLTINNLNVQNYVTVMNNLTVEGVSENT
YNEYISHGEDGVDNHLPSNSNNVMATHNIGMGRHGHNDGEAKKISEKYFHHYFLLQEEKR
RPSPLISGTHEYMDKTKLTHELASLALSQEKKMNGNNNLEMGLIVQSNFKVYLYTNSTLK
INILSHLCELQARTPNMVVGILTRRSVLNAYNSDITANQIIKFLESYAHPGRSNFKSSIP
VNVITQLKLWESERHRLTLDDAIVFKSFEKEFLPHLYQQIVVWANSKNYLLHYTPWPKNA
NSPEFDAWMKAEKYLCCIYESKNEIIDKIKEIREKLMKKRQNA
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggacaaggaaaaatatcgaaaatatggaaatttatgactacatgaaggaactg
agtgaaaaaatatggacctacctgtttgaggactccctagcacatgaggcaatattacag
tcgctaaacgagttagaacaaattattatctcaagattgttattcatacagcaggtggtg
tccgagagagcaatgcgcttgtggataaatccaaactctctaaagaaattaagtgaatgt
ataaaaaatctggtcgaagcaaaaatacttgtagagagcgaaacgaaaaaggataattac
aatcagtacagaataaatgaaaaattcagatatacaatgctaaacaaaatttataaaaat
agagaagacagaatttccatatttaataataacgctaaggagcaaatggaaaaagaaaaa
aatcttcttgaaaataatttatatccaacgaaggaagaaattctgaattatacacacatg
agatggaacaatttgctccatttcattgcttcccccaagttaagtcatatgaacaattat
atgatttacaataatggcatatcagtggagcatagacaggaggtatatcctccacatgct
acttttccagtcaaccgaaatgatgatcagggtgacccgaacaggaataaaaatgtagac
aaatcaacctcttccagttacaccccttcgaagaaaggaaggaaaaaaaatcaaacagac
gatgaggagtaccgacctcatggctacttcgtccatggtggaactgctcacaatgtggtg
aattacgccacgggaaaggaggatgaggaagacgaccaacctgtcggtgatgacgacaac
ggtgatgacgacaacgatgatgactccgatgagagggataactcagacaatggagaccac
aatgccgaggaggcaaaccaaatccatggagaaaaatacgagacaaatccaaatgaagag
gtcaaatatgatcagaaatatgaccagtacgggtactaccataaacagagtgaatctgtg
gaagcccccccaaatggaagcgcacacaatctgaatagtctgggtccaaatcagtattat
acccatcatagcagtaagaagaggaagaagaaaaagaaaaagggagtttatgcatacaag
caaaatgatctatattataggagcttgcaaaatgaggaaaatggctacctggaagaagac
aataatgattattcatttttctattccagtgcaaagaaggaaaccttcccttcgtacacc
ccatgtgatagtctaatcgaagtactcaagaggaaaaacttcatactacaagatgatgcg
aatagtaacaagacagtgaacatgagtcgagaagctttctcatggttcctcaaggacata
cgaagtaggataatttccttagtgctcgaatatttgctcatagtagacgatggctacctc
tcaaatgtcgcacgggaaatttcgaccaaatataagaaggccaatagtaacgcagatgcc
agtagtggtggaggaaattctgcgaatgcccaagatggggaaagcgattacggtacttat
accacttatgcgaataatagcacctacccccaacgccgtggaagtaacgacttgtatagc
ggccaaatccccacaacccatcaacagaaggtaaaaaatgatggaagtggaaacccgtgc
tatgtgacggaagaaaataaggagcacaaaaaatcagaattgtatgtgaaagaaacctta
ttgctgatcctatccattagtcagtgcactattagtcatcccatatacctcgataattta
acaaaagcacagaaggaatttataaattttggtatacacataggtctctttttaaagcgc
gctgaggactatgtctttgtaactccgtacgcgttacttctaacgattaataatttgaat
gtacagaattacgtgactgtgatgaacaatctcacagtggagggggtatctgaaaacaca
tacaacgagtatatctctcatggcgaggatggggtagacaatcatctacccagtaacagc
aacaatgttatggccacacacaacataggcatgggaagacatggtcataatgatggagag
gcgaagaagataagcgaaaaatattttcatcactatttcctcttacaagaggagaagaga
agaccatcccccctgataagtggtacccatgaatatatggacaaaacaaaactcacacac
gaattagctagccttgccttatcccaagaaaaaaaaatgaatggaaataataacctcgaa
atggggttaattgtacagagcaacttcaaagtctacctctacaccaactcaacattgaaa
ataaacatcttaagtcatttatgtgaattacaagcgaggacacctaacatggtggtagga
attttaacaagaagaagtgtgctaaatgcatataactccgacatcactgcaaatcaaata
attaaatttttggaatcctatgctcacccaggaagaagcaactttaaaagctccatacct
gttaatgttattacgcaattgaagttgtgggaatcggaaagacatagattaactctggac
gatgctatcgtctttaagtctttcgaaaaggaattcctccctcatctgtatcaacaaatc
gttgtctgggctaatagcaaaaattacctattgcattatacaccctggcccaaaaatgcc
aactccccagaattcgacgcctggatgaaggcggaaaagtacctctgctgcatttacgaa
tcgaagaatgaaattatcgataagattaaggaaattagggagaagcttatgaaaaagcgg
caaaacgcgtaa

DBGET integrated database retrieval system