KEGG   Parvibaculum lavamentivorans: Plav_0046Help
Entry
Plav_0046         CDS       T00580                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding type 2
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00010  Glycolysis / Gluconeogenesis
pla00071  Fatty acid degradation
pla00350  Tyrosine metabolism
pla00625  Chloroalkane and chloroalkene degradation
pla00626  Naphthalene degradation
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01120  Microbial metabolism in diverse environments
pla01130  Biosynthesis of antibiotics
pla01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plav_0046
  Lipid metabolism
   00071 Fatty acid degradation
    Plav_0046
  Amino acid metabolism
   00350 Tyrosine metabolism
    Plav_0046
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Plav_0046
   00626 Naphthalene degradation
    Plav_0046
Enzymes [BR:pla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Plav_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABS61669
JGI: Plav0046
UniProt: A7HP36
Position
49183..50193
Genome map
AA seq 336 aa AA seqDB search
MSASLPDKMRAMLLDAPGKPLRLASLPVPRPGPGEVLVKVEACGVCRTDLHVVDGELPEP
KLPLIPGHEIIGRVAALGEGVTALAPGARVGIPWLGWTCGACRYCRADKENLCENALFTG
YTRDGGYAEYALADARFCFPVAESYGAAEAAPLLCAGLIGYRSLRMAGEAGLLGIYGFGA
AAHIVAQVARHEGWRLFAFVKPGDEKAKEFALSLGAEWAGGSDETPPEPLDAAIIYAPAG
PLVPAALKTVAPGGRVVCAGIHMSDIPSFPYDILWRERSVHSVANLTRADGEAFLSLAPK
VPIVTTVETVPLAEANEALARLRDGRLTGAAVLVME
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctccctgccagacaagatgcgcgccatgctgctcgatgcgccgggaaagccg
ctgcgcctggcatcgcttcccgtgccgcgtcccggtcccggcgaagtgctggtgaaggtc
gaggcctgcggcgtctgccgtaccgatcttcacgtcgttgatggcgagttgccggaaccg
aaactccccctcattcccggccacgaaatcatcggccgcgtcgcagcccttggcgaaggc
gtcaccgccctcgctcccggtgcgcgtgtcggcattccctggctcggttggacctgcggt
gcctgccgctattgccgcgcggacaaggaaaatctttgcgagaacgcgctcttcacgggc
tacacgcgcgatggcggctatgccgaatatgcgctcgccgatgcgcgcttctgctttccc
gtcgccgaaagctatggcgcggcggaagcggctcccctcctctgcgccggactgatcggc
tatcgctcgcttcgcatggcgggagaggcaggcctgctcggcatctacggcttcggcgct
gccgcgcatatcgtggcgcaggtagcgcgccacgaaggctggcggctcttcgccttcgtg
aagcccggtgacgagaaggcaaaggaattcgccctttcgctcggcgccgaatgggcaggc
ggctccgatgagacgccgccggaacctctcgacgccgccatcatctatgcgcctgcgggg
cctctcgtccccgccgcgctcaagacggttgcgccgggcggccgcgtcgtctgcgccggc
atccacatgtcggacatcccgtcctttccctacgatattctctggcgcgagcggtcggtg
cattccgtcgccaatctcacccgcgccgatggcgaggcgtttctgtccctcgcgccgaaa
gtgcccattgtgacgacggtcgaaaccgtcccgctggccgaagcgaatgaagctctggcg
cggctccgcgacggccggctcacaggcgcggccgtgctggtgatggagtga

DBGET integrated database retrieval system