KEGG   Parvibaculum lavamentivorans: Plav_0142Help
Entry
Plav_0142         CDS       T00580                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Plav_0142
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plav_0142
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Plav_0142
Enzymes [BR:pla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Plav_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(158621..159460)
Genome map
AA seq 279 aa AA seqDB search
MTTRLEKRFAQLKGEGRAAFIAFITAGDPDFETSLGILKGLPAAGADVIELGMPFTDPMA
DGPAVQASTQRALRGGARMTKTLELVQKFREENTETPIVLMGYYNPIYHMGVENFLAKAI
DAGVDGLIVVDLPPEEDDELCEPALKAGLNFIRLATPTTDDKRLPAVLANTSGFVYYVSI
NGITGSASPQARNVAEAVARIKRHTSLPVAVGFGIRTPEQAAEIARSADGAVVGSAIVDA
IAHELDSSGKIRPEAVERVLGFVRSLADGVHTARAATAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacacggctcgaaaaacggttcgcgcaattgaagggcgagggccgcgcagccttc
atcgccttcatcacagcaggtgatccggactttgaaacctcgctcgggattctcaagggg
ctgccggctgcgggcgctgacgtgatcgaactgggcatgcccttcaccgatccgatggcg
gatggccctgccgtccaggcgtccactcagcgcgcgcttcgcggcggtgcgcgcatgaca
aagacacttgaactcgtacaaaaattccgcgaggagaacacggaaacgccgatcgtgctg
atgggctattacaatcccatctatcacatgggtgtcgaaaactttcttgcgaaggccatt
gatgccggagtggatggcttgatagtcgtcgatcttccgccggaggaagatgacgagcta
tgcgaacctgcgttgaaggcaggattgaatttcattcgtctggcgacacctacaaccgat
gacaagagattgcccgccgttctcgccaacacatcgggctttgtctattacgtttcgatc
aacggcattaccgggtccgcaagtccacaggcgcggaacgtggcggaagccgtggcgcga
atcaaacggcacacctctttgccggtcgcggtcggctttggcattcgcactcccgagcag
gcagcggaaatagcgcgttcagccgacggagcggtggttggttcagcaatcgtagacgcc
atcgctcacgaactcgacagcagcggcaagatcaggccggaggccgtcgagcgagtgctc
ggttttgtccggtcgctggcagacggcgttcacaccgcgcgtgcggctacggcagaatag

DBGET integrated database retrieval system