KEGG   Parvibaculum lavamentivorans: Plav_0270Help
Entry
Plav_0270         CDS       T00580                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Plav_0270
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Plav_0270
Enzymes [BR:pla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Plav_0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
291932..292408
Genome map
AA seq 158 aa AA seqDB search
MSAYEFEFRTIKGEALPLSRFSGKPILIVNTASRCGFTPQYRELEGLWERYRARGLTIIG
VPSNDFGAQEPGTEEEIVEFCEVNYSITFPLTAKQQVVGAEAHPFYLWVSEVAGEDARPR
WNFHKYLVGPDGALAGIYPSKVSPLDKILVDEIERLLA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctatgaattcgaattccgcaccatcaagggcgaggcgctgccgctgtcgcgc
ttttcgggaaagcccatcctcatcgtcaacacggcgagccgctgcggcttcacaccgcaa
tatcgcgagctggaaggcctgtgggaaaggtatcgcgcgcgcggcctgacgatcatcggc
gtgccgtccaatgatttcggcgcgcaggagccgggcaccgaggaagagatcgtcgaattc
tgcgaggtgaattattcgatcacttttccgctgaccgcaaagcagcaggtcgtcggcgcg
gaggcccatcccttctatctctgggtgagtgaagtggcgggcgaggatgcgcggccccgc
tggaacttccacaaatatctagtcgggccggatggcgcgcttgccggaatttatccaagc
aaggtgagcccgctcgacaaaatactggtggatgaaatcgaaagactgcttgcgtga

DBGET integrated database retrieval system