KEGG   Parvibaculum lavamentivorans: Plav_0309Help
Entry
Plav_0309         CDS       T00580                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plav_0309
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plav_0309
   00052 Galactose metabolism
    Plav_0309
   00500 Starch and sucrose metabolism
    Plav_0309
   00520 Amino sugar and nucleotide sugar metabolism
    Plav_0309
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Plav_0309
   00524 Butirosin and neomycin biosynthesis
    Plav_0309
Enzymes [BR:pla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Plav_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
333133..334137
Genome map
AA seq 334 aa AA seqDB search
MSLAGEASLLVADIGGTNARFALAASRNGRIEVSPPIIFQTADYASLELALSRFLEEAGR
PLIGGVAACAAGPVQGTGAAAHIAMTNCPWDVTAATLTRVTDIKHPRLMNDFAALALSIP
ALTGPDLHAVGPARDAVAGAPVGILGAGTGLGVSTLVFDGGRDIVVAGEGGHVDLAASNV
REAAVLAHLQSIYGHVSVERVLSGPGLVALYTALAALSGEEATPAPSPVEVAARARAGTC
VLAEEAVRLFCGWLGAVAGDLALTVGARGGIYIGGGIVPGWLAAGPGLFDEALFRARFEA
KGRFDAYLSDIPVFVIRRADAALLGLARAARAPL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctggcgggggaggcatcgctgctggtcgccgatatcggcggtaccaatgcacgc
tttgcgctggcggcctcgcgcaatggccgtatcgaggtttctccccccatcatcttccag
accgcggattatgcgagcctcgagctggcgctcagccgcttcctcgaggaggcgggccgc
ccgctcattggcggcgttgcagcctgcgccgccgggcccgtgcaggggacgggcgcagcc
gcgcatatcgccatgacgaactgcccctgggacgtgacggccgcaacgctgacgcgggtg
acggacattaagcatccgcgcctgatgaacgacttcgcggcgctggcactctcgatcccg
gccctcacggggcctgatcttcatgcggtcggtcctgcacgcgatgcggtggcgggagcg
cctgtcggcattctcggcgcaggtaccggcctcggcgtctcgacgcttgtgttcgacggc
ggccgcgacattgtcgtggcaggcgagggcggacatgtcgaccttgcggcttcgaatgtg
cgggaggcggcggtgctcgcgcatctccagtcgatctatgggcatgtttcggtcgagcgc
gttctgtccggtcccggccttgtcgcgctttacaccgctcttgccgcactgtcgggcgag
gaggcgacgcccgccccatcgccggtggaagtggcggcgcgcgcgcgggctggcacatgc
gtcctggcggaagaagcggttcgtctgttctgcggctggctcggcgccgtggccggcgat
cttgcgctcacggtcggcgcccggggcggcatctatatcggcggcggcatcgtgcccggc
tggctggcggcgggacccggccttttcgacgaggcgcttttccgcgcccgcttcgaggcg
aagggccgcttcgacgcttatctttccgatatccctgtcttcgtcatccgcagggcagac
gcggcgcttctcggcctcgctcgcgccgcgcgcgcgcctctctag

DBGET integrated database retrieval system