KEGG   Parvibaculum lavamentivorans: Plav_0519Help
Entry
Plav_0519         CDS       T00580                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pla00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pla00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
559146..560420
Genome map
AA seq 424 aa AA seqDB search
MDTIHIRGGRRLNGRIPVSGAKNAALPLMTAALLTDEPLRLTNMPRLADVRTLTKLLAEL
GGDVAIDRGEDADVMTIRVADIKSTTAPYEIVSQIRASFWVLGPLLARCHEAKVSLPGGC
AIGARPVDLYIKGLQKMGAEIDLVEGYVLAKAPGGLKGAVIRSPIVSVGATHTLMMAAAL
AEGVTVLENAAREPEIGDVANCLVAMGAKIEGIGTSTLRIEGVDRLHGATHRVIADRIEA
GTYAVAAAMTGGEVVLEGVEAETFEAALSVLRAAGAGVESEQGAVRIFRNGERLQATDVV
TQVFPGFPTDLQAQFMALMTTAEGESEITETIFENRFMHVQELARFGANISLHGDKALVH
GVEKLKGAPVMASDLRASAALIIAGLAAEGETTINRVYHLDRGFERIEAKLSACGAEIWR
EKAK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaccattcacattcgaggcggccgccgcctcaacgggcgcatccccgtcagcggc
gccaaaaatgcggccctgccgctgatgacggcggccctcctcacggatgagccgctccgc
ctgaccaacatgccgcgcctcgccgatgtgcgaacgctgacaaagctccttgccgagctt
ggtggcgatgtcgccatcgaccggggtgaggacgccgacgtcatgacgatccgcgtcgcc
gacatcaagtccaccaccgcgccttacgaaatcgtctcgcagatccgcgcgagcttctgg
gtcctcgggccccttctggcccgctgccacgaggccaaggtctcgctgccgggcggctgc
gccatcggcgcccgccccgtcgatctctatataaagggcctccagaaaatgggcgccgag
atcgatctcgtcgaaggctatgtgctggccaaggcgccgggcggcctcaagggcgccgtc
atccgctcgcccatcgtctcggtcggcgccacccacacgctgatgatggcggccgcgctc
gccgaaggcgtcaccgtgcttgaaaacgccgcccgcgagccggaaatcggcgatgtcgcc
aattgccttgtcgccatgggcgcgaagatcgagggcatcggcacctcgacgctccgcatc
gaaggcgtcgacaggctccacggcgccacccaccgcgtcatagcggaccgcatcgaagcc
ggaacctacgccgtcgccgccgctatgacgggcggcgaagtcgtgcttgaaggcgtcgag
gccgaaaccttcgaggccgcgctctccgtgctgcgcgccgccggcgccggtgttgaaagc
gagcagggcgccgtccgcatcttccgcaatggcgagcgcctgcaggcaacggatgtcgtg
acgcaggtcttccccggcttcccgaccgatcttcaggcccagttcatggcactgatgacg
acggcggaaggcgaatccgaaatcaccgaaacgattttcgaaaaccgtttcatgcatgtg
caggaactcgcccgcttcggcgccaacatctcgcttcatggcgacaaggcgctggtccac
ggcgtcgaaaagctgaaaggcgctcccgtcatggcgagcgatcttcgcgcctccgccgcc
ctcatcatcgccgggttggccgccgagggcgaaaccaccatcaaccgcgtctatcatctc
gatcgcggcttcgagcgtatcgaggcaaagctcagcgcctgcggcgccgagatatggcgt
gaaaaggcaaagtag

DBGET integrated database retrieval system