KEGG   Parvibaculum lavamentivorans: Plav_0521Help
Entry
Plav_0521         CDS       T00580                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00340  Histidine metabolism
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Plav_0521
Enzymes [BR:pla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Plav_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABS62144
JGI: Plav0521
UniProt: A7HQG1
Position
561111..562406
Genome map
AA seq 431 aa AA seqDB search
MPIRLNAADASFENAFAALLTGKREASVDVADTVAKIIADVRARGDEALIEYTKRFDRLE
NLDAGSLAISQADLDAAIDACDAKTLDALKTAAMRIEAYHERQRPEDARFTDTAGVELGH
RWTPVSAVGLYVPGGTANYPSSVLMNAIPAKVAGVARVVMVVPTPDGVVNPLVLAAAKIS
GVDEVYRVGGAQAVAALAYGTATIAPVDKIVGPGNAFVAAAKRQVFGQVGIDMIAGPSEI
LVLADGDNDPEWIAADLLSQAEHDESSQSILITDDAGFATRVEEAVARQLKALPRETTAT
KSWADFGAVIVVSKLEDAVPLVDRLAPEHLEIATADPDVLLARVSNAGAIFLGRHTPEAI
GDYVAGSNHVLPTARSARFSSGLNVLDFMKRTSIVRCDPEALRAIGPAALALAEAEGLDA
HARSVSIRLNM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccatccgcctcaatgccgccgacgccagctttgaaaacgctttcgccgctctcctc
accggaaagcgcgaagcctcggtcgatgtcgccgacacggtggcgaaaatcatcgcggat
gtccgtgcgcgcggcgatgaagccctcatcgaatacacgaagcgtttcgaccgcctcgaa
aatctcgacgccggttcgctcgccatctcgcaagccgatctcgatgccgccatcgatgcc
tgtgacgcaaagacgctcgacgctttgaaaaccgccgccatgcgtatcgaggcctatcac
gagcgccagcgcccggaagatgcgcgcttcaccgatacggccggtgtagaacttggtcac
cgctggacacccgtctccgctgtcggcctctatgtaccgggcggtaccgccaattaccca
agctccgtcctgatgaacgccatcccggccaaggtcgcgggcgtcgcgcgcgtcgtcatg
gtcgtgcccacgccggatggcgtggtgaacccgctggtgctggccgccgcgaaaatttcc
ggcgtcgatgaagtctaccgcgtcggcggcgcgcaggccgtcgccgccctcgcttatggc
acagccaccatcgcgccggtcgacaagatcgtcggccccggcaatgcctttgtcgccgcg
gcgaagcgccaggtcttcggccaggtcggcatcgacatgatcgcgggcccttccgaaatc
ctcgtcctcgccgacggtgacaacgacccggaatggatcgccgccgatcttctctcgcag
gccgaacacgatgaaagctcgcagtcgatcctgataacggacgatgccggtttcgccacc
cgcgtcgaggaagcggttgcgcgccagttgaaggcgctcccgcgtgaaaccaccgcaacg
aaaagctgggccgatttcggtgccgtcatcgtggtgtcgaagctcgaagatgccgtgccg
ctcgtcgaccgcctcgcccccgaacatctcgaaatcgccaccgccgatccggatgtgctc
ctcgcccgcgtttccaatgccggcgccatcttcctcggccgccacacgccggaagccatt
ggcgattatgttgcgggctccaaccacgtgctgcccaccgcccgcagcgcgcgcttctcg
tcgggcctcaatgtgctcgacttcatgaaacgcacctccatcgtccgctgcgaccccgag
gccctgcgcgccatcggccccgccgcgcttgccctcgccgaagccgaaggcctcgacgcc
cacgcccgctccgtctcgatccggctgaatatgtga

DBGET integrated database retrieval system