KEGG   Parvibaculum lavamentivorans: Plav_0542Help
Entry
Plav_0542         CDS       T00580                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pla00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
587813..590011
Genome map
AA seq 732 aa AA seqDB search
MEGGDRLEYAAGALLEGRLTDPFALLGPHAQDDGYVVRTFQPGAESVSLIARSGGEDIGT
LEEISDGLFAGRMKEDKPYSLRILWPGGAVQEVEDAYSFGPVLGDLDLYLFGEGRHWDLA
RVLGAQPRTIEGVAGVAFAVWAPNARRVSVIGDFNNWDGRRHPMRLRHGAGIWELFVPRL
GQGTRYKYEIAGADGSTTQRADPVARATEAPPATASVVAAPPDYRWTDEDWLAERASRQR
PNAAISIYEVHAASWVRPEGNVEGTLDWNALIDRLIPYVADMGFTHVEFLPIMEHPFGGS
WGYQTLSQFAPSARFGKPEDFARFVDACHRAGIGVILDWVPAHFPTDPHGLAHFDGTHLY
EHADPREGFHPDWNTMIYNLGRTEVAGFLLASALWWIETFHVDGLRVDAVASMLYRDYSR
KAGEWVPNIHGGRENLESVDFLKRLNAIIAERCPGAVTIAEESTAWPGVSAPLKSGGLGF
SYKWNMGWMHDTLQYVERDPLYRKWHHSEMTFGLVYAFSEKFVLPLSHDEVVHGKGSLIG
KMPGDRWRKFATLRAYYTFMWTHPGKKLLFMGGEIAQDSEWNHDAEVAWHLLSIPEHAAV
QRLVRDLNRLYASEPALHARDTEPAGFQWIVGADAERSVFVYARYGETGTPPMVVLVNMT
PEPCTDYRIGMPLAGQWREILNSDAAIYGGGNIGNAGLVEARAAPAHGQPASASVVLPPL
AAVILQHEGPNR
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggcgacaggctcgaatatgcggcgggggctctgctcgaagggcgtttgacc
gatccgttcgcgctgctcggaccgcatgctcaggatgatggatatgtcgtccgtacattt
cagccgggcgcggaaagtgtgtcacttatcgcgcgctccggcggcgaggacatcggcacg
ctcgaggagatttcggacgggctctttgcgggccggatgaaggaggacaagccctatagc
ttgcgcatcctctggcccggcggtgcggtgcaggaggtcgaggatgcctattccttcggc
ccggtgctcggagacctcgacctgtatctcttcggcgaaggccggcattgggatctcgcg
cgcgtcctcggcgcgcaaccgcgaacgatcgaaggcgttgcgggcgttgccttcgcggta
tgggcgccgaatgcgcggcgcgtatccgtcattggcgatttcaacaattgggatggacgg
cggcacccgatgcggctgcgccatggcgcggggatatgggagctcttcgtgccgcggctc
ggccagggcacacgctacaaatacgaaatcgcgggtgcggacggcagcacgacgcaaaga
gccgaccctgtcgcgcgcgccaccgaggcaccgcctgcgacggcatcggtcgtcgccgcg
ccgccggactatcgctggacggatgaagactggctcgctgaacgcgcctcccgccagcgc
ccgaatgccgcgatctcgatctacgaggtacatgcggcctcatgggtacggccggagggg
aacgtggaaggtacgctcgactggaatgcgctgatagacaggctcattccctatgtcgcc
gacatgggcttcacgcatgtcgagttcctgcccatcatggagcatccgttcggtggctcg
tggggataccagacactctcgcaattcgcgccctccgcgcgcttcgggaaaccggaggat
ttcgcgcggttcgttgatgcatgtcaccgcgccggcatcggcgtcatcctcgactgggta
ccggctcattttccgacggacccgcacggcctcgcccatttcgatggaacgcatctctat
gaacatgcggacccgcgggagggctttcatcccgactggaatacgatgatctacaatctc
ggccggacggaagttgcgggctttcttcttgcgtcggcgctttggtggatcgagaccttt
catgtcgatgggctacgtgtcgacgccgttgcgtcgatgctttaccgggattacagccgc
aaggccggcgaatgggtgccgaacattcatggcgggcgggaaaatctggaatccgtcgac
ttcctgaagcggctcaatgccatcatcgcggaacgctgcccgggcgccgtcaccatcgcc
gaggagtcgaccgcatggccgggcgtttcggcgccgctcaaaagcggagggctcggcttt
tcctacaagtggaacatgggctggatgcacgacacgctccaatatgtggagcgcgatccg
ctctatcgcaaatggcatcactccgagatgaccttcgggcttgtctatgcgttctcggag
aaattcgttctgccgctgagccatgacgaagtggtgcatgggaaaggctcgctgatcggg
aagatgccgggcgaccggtggcggaaattcgcgacgctacgcgcctactacaccttcatg
tggacgcatcccggcaagaagctccttttcatggggggcgagatcgcgcaggacagcgag
tggaaccacgatgccgaagtcgcgtggcacttattgtcgatccccgaacacgccgccgtg
caacgcctcgtccgcgacctcaatcggctctatgcgagcgaaccggcactccacgcacgc
gacacggagcctgcgggctttcaatggatcgtcggcgcagacgcggagcgcagcgttttc
gtctatgcgcgatatggcgagaccggaacgccgcccatggtggtgctcgtcaacatgacg
ccggagccatgcaccgactaccggatcggcatgccgcttgccgggcagtggcgcgaaata
ttgaacagcgacgcggccatttacggcggcggcaacatcggcaatgccggtctggtggaa
gcgcgcgcggcgcctgcccatggccagcctgcaagcgcgagcgtcgtgctgccgcctctg
gccgccgttattctccagcatgagggaccgaaccgatga

DBGET integrated database retrieval system