KEGG   Parvibaculum lavamentivorans: Plav_0542Help
Entry
Plav_0542         CDS       T00580                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00500  Starch and sucrose metabolism
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Plav_0542
Enzymes [BR:pla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Plav_0542
Exosome [BR:pla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Plav_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ABS62165
JGI: Plav0542
UniProt: A7HQI2
Position
587813..590011
Genome map
AA seq 732 aa AA seqDB search
MEGGDRLEYAAGALLEGRLTDPFALLGPHAQDDGYVVRTFQPGAESVSLIARSGGEDIGT
LEEISDGLFAGRMKEDKPYSLRILWPGGAVQEVEDAYSFGPVLGDLDLYLFGEGRHWDLA
RVLGAQPRTIEGVAGVAFAVWAPNARRVSVIGDFNNWDGRRHPMRLRHGAGIWELFVPRL
GQGTRYKYEIAGADGSTTQRADPVARATEAPPATASVVAAPPDYRWTDEDWLAERASRQR
PNAAISIYEVHAASWVRPEGNVEGTLDWNALIDRLIPYVADMGFTHVEFLPIMEHPFGGS
WGYQTLSQFAPSARFGKPEDFARFVDACHRAGIGVILDWVPAHFPTDPHGLAHFDGTHLY
EHADPREGFHPDWNTMIYNLGRTEVAGFLLASALWWIETFHVDGLRVDAVASMLYRDYSR
KAGEWVPNIHGGRENLESVDFLKRLNAIIAERCPGAVTIAEESTAWPGVSAPLKSGGLGF
SYKWNMGWMHDTLQYVERDPLYRKWHHSEMTFGLVYAFSEKFVLPLSHDEVVHGKGSLIG
KMPGDRWRKFATLRAYYTFMWTHPGKKLLFMGGEIAQDSEWNHDAEVAWHLLSIPEHAAV
QRLVRDLNRLYASEPALHARDTEPAGFQWIVGADAERSVFVYARYGETGTPPMVVLVNMT
PEPCTDYRIGMPLAGQWREILNSDAAIYGGGNIGNAGLVEARAAPAHGQPASASVVLPPL
AAVILQHEGPNR
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggcgacaggctcgaatatgcggcgggggctctgctcgaagggcgtttgacc
gatccgttcgcgctgctcggaccgcatgctcaggatgatggatatgtcgtccgtacattt
cagccgggcgcggaaagtgtgtcacttatcgcgcgctccggcggcgaggacatcggcacg
ctcgaggagatttcggacgggctctttgcgggccggatgaaggaggacaagccctatagc
ttgcgcatcctctggcccggcggtgcggtgcaggaggtcgaggatgcctattccttcggc
ccggtgctcggagacctcgacctgtatctcttcggcgaaggccggcattgggatctcgcg
cgcgtcctcggcgcgcaaccgcgaacgatcgaaggcgttgcgggcgttgccttcgcggta
tgggcgccgaatgcgcggcgcgtatccgtcattggcgatttcaacaattgggatggacgg
cggcacccgatgcggctgcgccatggcgcggggatatgggagctcttcgtgccgcggctc
ggccagggcacacgctacaaatacgaaatcgcgggtgcggacggcagcacgacgcaaaga
gccgaccctgtcgcgcgcgccaccgaggcaccgcctgcgacggcatcggtcgtcgccgcg
ccgccggactatcgctggacggatgaagactggctcgctgaacgcgcctcccgccagcgc
ccgaatgccgcgatctcgatctacgaggtacatgcggcctcatgggtacggccggagggg
aacgtggaaggtacgctcgactggaatgcgctgatagacaggctcattccctatgtcgcc
gacatgggcttcacgcatgtcgagttcctgcccatcatggagcatccgttcggtggctcg
tggggataccagacactctcgcaattcgcgccctccgcgcgcttcgggaaaccggaggat
ttcgcgcggttcgttgatgcatgtcaccgcgccggcatcggcgtcatcctcgactgggta
ccggctcattttccgacggacccgcacggcctcgcccatttcgatggaacgcatctctat
gaacatgcggacccgcgggagggctttcatcccgactggaatacgatgatctacaatctc
ggccggacggaagttgcgggctttcttcttgcgtcggcgctttggtggatcgagaccttt
catgtcgatgggctacgtgtcgacgccgttgcgtcgatgctttaccgggattacagccgc
aaggccggcgaatgggtgccgaacattcatggcgggcgggaaaatctggaatccgtcgac
ttcctgaagcggctcaatgccatcatcgcggaacgctgcccgggcgccgtcaccatcgcc
gaggagtcgaccgcatggccgggcgtttcggcgccgctcaaaagcggagggctcggcttt
tcctacaagtggaacatgggctggatgcacgacacgctccaatatgtggagcgcgatccg
ctctatcgcaaatggcatcactccgagatgaccttcgggcttgtctatgcgttctcggag
aaattcgttctgccgctgagccatgacgaagtggtgcatgggaaaggctcgctgatcggg
aagatgccgggcgaccggtggcggaaattcgcgacgctacgcgcctactacaccttcatg
tggacgcatcccggcaagaagctccttttcatggggggcgagatcgcgcaggacagcgag
tggaaccacgatgccgaagtcgcgtggcacttattgtcgatccccgaacacgccgccgtg
caacgcctcgtccgcgacctcaatcggctctatgcgagcgaaccggcactccacgcacgc
gacacggagcctgcgggctttcaatggatcgtcggcgcagacgcggagcgcagcgttttc
gtctatgcgcgatatggcgagaccggaacgccgcccatggtggtgctcgtcaacatgacg
ccggagccatgcaccgactaccggatcggcatgccgcttgccgggcagtggcgcgaaata
ttgaacagcgacgcggccatttacggcggcggcaacatcggcaatgccggtctggtggaa
gcgcgcgcggcgcctgcccatggccagcctgcaagcgcgagcgtcgtgctgccgcctctg
gccgccgttattctccagcatgagggaccgaaccgatga

DBGET integrated database retrieval system