KEGG   Parvibaculum lavamentivorans: Plav_0545Help
Entry
Plav_0545         CDS       T00580                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pla00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
593834..595843
Genome map
AA seq 669 aa AA seqDB search
MSRIVSLAQAAGIQVEWTDAAGRRQRVSEDALSAILAALGLPADSSSAIADSCNRLEERA
SGETSFLSGDQGSVIRLQGRYGGAKRARLVLEDGSARDVVLEDGQDGAMLPAIGQPGYHR
LLLDDHEVQLAVAPPHCYPIGEATGGRRVWGPAIQIAALRDARETSYGDYSSLADAARAF
SERGADAMAISPVHALFPADTSRYSPYAPSSRLFLNVFYADPALIGGAMPSAPRAALIDW
PAAIPERLGALRAAYDGRDAGVKEAVSAYVAEAGEELRRHALFDALHAHFFRQSGAGGWQ
DWPIEYRNPSDRAVATFAAAHEDEVGFYIFLQWLAEKGLDEAQRSARQAGMAIGLIADLA
VGMDAGGSHAWSRPEELLTGLSIGAPPDPLGPDGQNWGITGFSPQALQRTGFDAFIATIR
AALRHAGGIRIDHALGLRRLWVVPSGASSADGAYLTYPLDDMLRLLALESQRAKAIVIGE
DLGTVPEGLREEMGRKEMLGMRVLWFERGADEAFLPPKEWQGKAAAMTGTHDLPTVAGWW
SGRDIDWTWNLKRKADAPSEAEHREGRERERTKFWAAMRDAGVTDAAMPEPDDANPVLDA
ALAFVSETPCPIAILPMEDIVGLVEQPNLPGTMNEHPNWCRRMPGPTRDLLDQPDIARRI
AILKSKRAR
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggatcgtctcattggctcaggccgcgggtattcaggtcgagtggacggatgct
gccggcagacggcagcgcgtcagcgaagacgccctttcggcgatcctcgcggcactcggc
ttgcccgccgacagcagctcggcgattgccgatagctgcaaccggctggaagagcgcgcc
agcggtgaaacctcttttctttcaggcgatcaaggcagtgtgatccggttgcagggccgt
tatggcggagcgaagcgggcgcggcttgttctggaggatggctccgcgcgcgacgtggta
ctggaggacggacaggatggcgcgatgctccctgccatcggccaaccgggctaccatcgg
ctcttgctggacgatcacgaagtgcagctcgcagtagcgcccccgcattgctatccgata
ggtgaagccaccggggggcgtcgcgtctggggccccgccatacaaattgcggcactgcgc
gatgcgcgcgaaacgagctatggcgactacagttctcttgccgatgccgcccgcgccttt
agcgagagaggcgccgatgccatggcgatcagccctgtgcacgcacttttcccggccgat
acaagccgctacagcccctacgcgccatcgagccggctgttcctgaacgtcttctatgcg
gacccggccctgatcggcggcgccatgccgtcagctccgcgagcagcacttatcgactgg
ccagccgcgatacccgaacgtctgggcgcgcttcgggcggcttacgacggacgggacgcg
ggcgtgaaggaggccgtctcagcctatgtcgcggaggccggagaggaactgcggcggcac
gccctcttcgacgcgcttcacgcccattttttcaggcagagcggagcaggtggctggcag
gattggcccatcgaatatcgcaacccatcggaccgggcggtagccaccttcgcggccgcg
catgaagacgaggtcggtttttatattttcctgcaatggcttgcggaaaagggtctcgac
gaggcgcagcggtcggcgcgacaggcgggcatggcaatcggccttattgccgatctcgca
gttggcatggacgcggggggcagtcatgcctggagccggccggaagaactgctgaccggg
ctgtcgattggcgcaccgcccgatccgcttgggcccgacggacaaaactggggcatcacc
ggattttcgccgcaggcactccagcgcaccggctttgatgcgttcatcgccaccatacgc
gccgcgcttcgccacgctggcggcattcgcatcgaccatgcgctcgggctgcgccgccta
tgggtggtgccgtcgggcgcctcatccgcggatggcgcctatctcacttatcccctcgac
gacatgcttcgcctgctcgcactggaatcgcaacgcgccaaggcgatcgtcataggcgag
gacctcggcaccgttcccgaagggcttcgcgaggagatgggcaggaaagaaatgctcggc
atgcgcgttctctggtttgaacgcggtgcggacgaggcattccttcccccgaaggagtgg
caggggaaggcagccgcgatgaccggcactcacgacctgccgacagtcgccggctggtgg
agcggcagagatatagactggacgtggaatttgaagcgaaaggcggacgcaccaagtgag
gcggagcatcgggagggtcgcgaacgggagcggacaaaattctgggcggccatgcgcgat
gccggcgtgacggacgcggcgatgccggagccggatgatgcgaaccctgttctggacgcc
gctcttgcctttgtgagtgaaacgccttgcccaatcgccattctgccgatggaagacatc
gtagggctggtggagcagccgaatctgccaggcaccatgaacgagcatcctaactggtgc
cggcggatgccgggaccgacccgcgacctgctcgatcagccggatattgcccggcgtatc
gccatcctcaaatcgaagagagcaagatga

DBGET integrated database retrieval system