KEGG   Parvibaculum lavamentivorans: Plav_0566Help
Entry
Plav_0566         CDS       T00580                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00071  Fatty acid degradation
pla00280  Valine, leucine and isoleucine degradation
pla00281  Geraniol degradation
pla00310  Lysine degradation
pla00360  Phenylalanine metabolism
pla00362  Benzoate degradation
pla00380  Tryptophan metabolism
pla00410  beta-Alanine metabolism
pla00627  Aminobenzoate degradation
pla00640  Propanoate metabolism
pla00650  Butanoate metabolism
pla00903  Limonene and pinene degradation
pla00930  Caprolactam degradation
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01120  Microbial metabolism in diverse environments
pla01130  Biosynthesis of antibiotics
pla01212  Fatty acid metabolism
Module
pla_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Plav_0566
   00650 Butanoate metabolism
    Plav_0566
  Lipid metabolism
   00071 Fatty acid degradation
    Plav_0566
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Plav_0566
   00310 Lysine degradation
    Plav_0566
   00360 Phenylalanine metabolism
    Plav_0566
   00380 Tryptophan metabolism
    Plav_0566
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Plav_0566
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Plav_0566
   00281 Geraniol degradation
    Plav_0566
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Plav_0566
   00627 Aminobenzoate degradation
    Plav_0566
   00930 Caprolactam degradation
    Plav_0566
Enzymes [BR:pla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Plav_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABS62189
JGI: Plav0566
UniProt: A7HQK6
Position
complement(623244..624035)
Genome map
AA seq 263 aa AA seqDB search
MSEPVILVEKSGAVATVTLNRPGAMNALSRDLRKAIAETFEELEADENIRVAILTGAGKA
FCAGLDLKELGGDASAVGGGGVNSTIGDKDPVTSIGRFSGPVIGAINGVAITGGFELAIA
CDVLVCSENARFADTHARVGILPGWGLSQKLSRAIGIYRAKELSLTGNFLSAQQAEQWGL
VNRVVTAEELLPVCRKLADDMLSVVPQCLPAYKKLIDDGFAQDFGTALKTERQFSNAANK
SVAPEEIAARREGIQNRGKQQTS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacccgtcatccttgtcgaaaagtccggcgccgttgccaccgtgacgctgaac
cgtccgggcgcgatgaacgcgttgtcgcgcgacctgcgcaaggcaatcgccgaaaccttc
gaggaacttgaagccgacgagaatatccgtgttgcgatccttaccggcgcgggcaaagcc
ttctgcgcaggcctcgacctgaaggaactcggcggcgatgccagcgccgttggcggcggc
ggcgtcaactcgaccatcggcgacaaggatcccgtcacctccatcggccgcttctcgggc
ccggtcatcggcgcgatcaacggcgtcgccatcaccggcggcttcgaactcgcgattgcc
tgcgacgtccttgtctgctcggagaatgcgcgctttgccgatacgcatgcccgtgtcggc
atcctgccgggctggggcctcagccagaagctcagccgcgccatcggcatctatcgcgcc
aaggaactttccctcaccggcaatttcctctccgcgcagcaggcggaacaatggggcctc
gtcaatcgcgtggtgacggcggaagaactccttcccgtctgccgcaagctcgccgacgac
atgctctcggtcgtgccgcaatgcctgcctgcctacaagaagctgatcgatgatggcttc
gcgcaggatttcggtaccgcgctcaagaccgagcggcaattctccaacgccgccaacaaa
tccgtcgcgccggaggaaatcgcggcgcgccgcgaaggcatccagaaccgcggcaagcag
cagacctcctga

DBGET integrated database retrieval system