KEGG   Parvibaculum lavamentivorans: Plav_0592Help
Entry
Plav_0592         CDS       T00580                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00630  Glyoxylate and dicarboxylate metabolism
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01120  Microbial metabolism in diverse environments
pla01200  Carbon metabolism
Module
pla_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Plav_0592
Enzymes [BR:pla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Plav_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABS62215
JGI: Plav0592
UniProt: A7HQN2
Position
complement(651931..653229)
Genome map
AA seq 432 aa AA seqDB search
MSKKTFYDLVPGAPKGRFDNVKRNYSVEDVEKLRGSFPIEYTLATRGANKLWELLHTTDY
VHSLGALSGNQAMQMARAGLKAIYLSGWQVAADANTAGAMYPDQSLYPANAGPELAKKIN
RALKRADEIEHSEGGAKRDWFLPIVADAEAGFGGPLNCFEIMKAYIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPSRAHERNLNAARLAADVSGTPTLIMARTDAESANLITSDIDERDH
EFIDFEKGRTIEGFYRLKPGTGVDHCIKRGLSFAPYADLLWWETSKPNLDDAKRFAEAIR
KEYPDQLLAYNCSPSFNWEANLDKATIAKFQKEIAAMGYKYQFVTLAGFHQLNHGMFELA
SGYRDRGMAAYSELQQAEFASESKGYTATRHQREVGTGYFDMVSIAAAGGESSTTALGDS
TEADQFKKAGAH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagaccttttacgatctcgtccccggagcgcccaagggccgcttcgacaat
gtgaagcgcaactacagcgtcgaagacgtcgagaagctgcgcggctccttccccatcgag
tacacgctcgccacgcgcggcgcgaacaagctctgggaactcctgcacacgaccgactat
gtgcattcgctgggcgccctttccggcaaccaggccatgcagatggcgcgcgcgggcctg
aaggcgatctatctctcgggctggcaggttgccgccgacgccaacaccgccggcgcgatg
tatcccgaccagtcgctctatcccgcgaatgccggtccggaactcgcgaagaagatcaac
cgtgcgctcaagcgcgccgacgagatcgagcattcggaaggcggcgccaagcgcgactgg
ttcctgccgatcgtcgccgacgcggaagccggtttcggcggcccgctcaactgcttcgaa
atcatgaaggcctatatcgaagcgggcgccgccggcgtccactacgaagaccagctcgcg
tcggaaaagaagtgcggccatctcggcggcaaggttctgatcccgagccgcgcccatgag
cgcaacctgaacgccgcgcgcctcgccgccgacgtttccggcacgccgacgctcatcatg
gcgcgtaccgacgccgaaagcgcgaacctcatcacgtcggacatcgacgagcgcgatcac
gagttcatcgatttcgagaagggccgcaccatcgaaggcttctaccgcctgaagccgggc
acgggcgtcgatcattgcatcaagcgcggcctctccttcgcgccttatgccgacctgctc
tggtgggaaacttccaagccgaacctcgacgatgcgaagcgtttcgccgaggccatccgc
aaggaatatccggaccagctcctcgcctataactgctcgccctccttcaactgggaagcg
aatctcgacaaggcgaccatcgcgaagttccagaaggaaatcgcggcgatgggctacaag
taccagttcgtcacgctggcgggcttccaccagctcaaccacggcatgttcgaactcgcg
tcgggctaccgcgaccgcggcatggccgcctattccgaactccagcaggccgaattcgcc
tcggagtcgaagggctacaccgcgacccgccaccagcgcgaagtcggcaccggctatttc
gacatggtctccatcgcggcggccggtggcgaaagctccaccacggcgctcggtgactcg
accgaagccgaccagttcaagaaagccggcgcccactaa

DBGET integrated database retrieval system