KEGG   Parvibaculum lavamentivorans: Plav_0593Help
Entry
Plav_0593         CDS       T00580                                 

Definition
(GenBank) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plav_0593
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Plav_0593
   00630 Glyoxylate and dicarboxylate metabolism
    Plav_0593
Enzymes [BR:pla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Plav_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(653264..654889)
Genome map
AA seq 541 aa AA seqDB search
MSKAAATTIADGVAVKGALKPGYERVLTPEALAFVAELERNFGERRRELLAARAERQKKF
DAGELPDFLPETKSIREGDWKVAPIPKDLLDRRVEITGPVDNRKMVINALNSGAQSYMTD
FEDAAAPTWDNMIGGQLNMMAYWDKEIGFTDETNGKRYDVVAKPATLIVRPRGWHLEEAH
VEIDGQAMSGSLFDFGLYFFHNAKRQIASGSGPYFYLPKMESHKEARLWNDVFVHAQKKL
GIPNGTIKVTVLIETLPAAFEMHEILYELKDHIVGLNCGRWDYIFSYIKRLGKNPNFILP
DRAQVVMGDAFLNAYSLLLVKTCHERGAFAMGGMAAQIPVKGDEAANEAAFNKVRADKER
EANNGHDGTWVAHPDLVKVAMEIFGKLEGPNQLARQRQDVNVGQKELLQPHKGERTEHGM
RECCRVGVQYIEAWIGGRGAVPLYNLMEDAATAEISRTQIWQWIYHGATLSDGRKVTPEL
FRDVLEDEMKSLRETLGETRWNEGHFEQAIGLFSEMTTARECEEFLTLPAYRLILENETR
P
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcagcagccacgacgatcgcggacggcgttgccgtcaagggcgccctcaag
ccgggctatgagcgggtgctgacgccggaggcgctggccttcgtcgcggagcttgagcgc
aatttcggggagcgccgccgcgagttgctggccgcccgcgccgaacgccagaagaagttc
gatgccggcgagctgcccgacttcctgcccgagacgaagtcgatccgcgagggcgactgg
aaggtcgcgccgatcccgaaggatttgctcgaccgccgcgtcgagatcaccggcccggtc
gacaaccgcaagatggtcatcaacgcgctcaattccggcgcgcagtcctacatgaccgac
ttcgaggacgccgccgcgccgacctgggacaacatgatcggcggccaactgaacatgatg
gcctattgggacaaggaaatcggcttcaccgacgagacgaacggcaagcgttacgacgtg
gtcgcgaagcccgcgacgctgatcgtccgcccgcgcggctggcatctggaagaagcccat
gtcgagatcgacggccaggcgatgtccggcagcctgttcgatttcggcctctacttcttc
cacaacgccaagcgccagatcgcatccggctccggcccttatttctatctgccgaagatg
gagagccacaaggaagcccgcctctggaacgacgtcttcgtccatgcgcagaagaagctc
ggcatcccgaacggcacgatcaaggtcaccgtcctgatcgagacgctgcccgccgccttc
gagatgcacgaaatcctttatgagctgaaggaccacattgtcggcctcaattgcggccgc
tgggactacatcttcagctatatcaagcggctcggcaaaaacccgaacttcatcctgccg
gaccgcgcgcaggtcgtgatgggcgatgccttcctcaatgcctattcgctgctgctggtg
aagacctgccatgagcgcggcgccttcgcgatgggcggcatggccgcgcagatccccgtg
aagggcgacgaggcggcgaacgaagccgccttcaacaaggtccgcgccgacaaggaacgc
gaagccaataacggccatgacggcacctgggtcgcccatcccgatctcgtgaaggtcgcg
atggaaatcttcggcaagctcgaaggcccgaaccagctcgcccgccagcgccaggacgtg
aatgtcggccagaaggaattgctgcagccccacaagggcgagcgcaccgagcatggcatg
cgcgaatgctgccgcgtcggtgtgcagtatatcgaggcgtggatcggcggccgtggtgcc
gtgccgctctacaacctcatggaagacgccgccaccgccgagatcagccgcacgcagatc
tggcagtggatctatcacggcgccacgctttccgacggccgcaaggtcacgccggaactc
ttccgcgacgtgctggaagacgaaatgaaaagcttgcgcgaaacgcttggcgagacgcgc
tggaatgaaggtcacttcgagcaggcaatcggcctcttctcagagatgaccacggccagg
gaatgcgaggagttcctgacgctgcctgcctaccgcctcattctcgaaaacgaaacccgc
ccctga

DBGET integrated database retrieval system