KEGG   Parvibaculum lavamentivorans: Plav_0616Help
Entry
Plav_0616         CDS       T00580                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plav_0616
   01230 Biosynthesis of amino acids
    Plav_0616
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plav_0616
   00030 Pentose phosphate pathway
    Plav_0616
   00051 Fructose and mannose metabolism
    Plav_0616
   00052 Galactose metabolism
    Plav_0616
  Energy metabolism
   00680 Methane metabolism
    Plav_0616
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Plav_0616
Enzymes [BR:pla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plav_0616
Protein phosphatases and associated proteins [BR:pla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Plav_0616
Messenger RNA biogenesis [BR:pla03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Plav_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
681834..682988
Genome map
AA seq 384 aa AA seqDB search
MRLGILTGGGDVPGLNPCIKAVVRRATELGWEVLGFRRGWAGPMSYNPDDPEGSEKHLMR
LNNDAVRTIDRKGGTILHTTRTDPQWMVEEKLPDFLKGKFKPSEKGTVDTTPHILRVFEH
LGIDVMVTIGGDGTLNYAAQLDREGMKIVSIPKTMDNDVFGTDYCIGFSTAVTRSVDAIS
ALRTSTGSHERIAVVELFGRNSGETALISSYLADADRAIIAEVPFNAEKLAALVAADRME
NPARYAMVVISEGAMMEGGEAQTYGQADEYGRKRLGGIGHLLGEELTRLTGVDTITQSLA
YLMRAGAPDALDQMVAKGFGTLAVQEIAAGRTGFMTAVRDGNYTTVPASTCASGGKRVDV
ASFYDAEAYRPRIAEVKGKPMFLY
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttggaatcctgaccggcggcggcgatgtgccggggctcaatccctgcatcaag
gcggtggtgcggcgcgcgactgaacttggctgggaagtgctcggcttccggcgcggctgg
gcagggccgatgagctacaatcccgacgacccggaagggagcgagaagcacctgatgcgg
ctcaacaacgatgccgtcaggaccatcgaccgcaagggcggcacgatactgcatacgacg
cgcaccgacccgcaatggatggtggaggaaaagctccccgatttcctgaagggaaagttc
aaaccgagcgaaaagggcacggtcgacacgacgccgcatatattgcgcgtctttgaacat
ctcggcatcgatgtgatggtgacgatcggcggcgacggcacgctgaactatgccgcgcag
ctcgaccgcgaaggcatgaagatcgtctcgatcccgaagacgatggacaatgatgttttc
ggcacggattactgcatcggcttttcgacggcggtgacgcgctcggtcgatgccatcagc
gcacttcgcacatcgacgggaagccatgaacgcatcgccgtggtggagcttttcggacgg
aactccggcgagacggcgctgatctcaagttatctcgccgacgccgaccgggcgatcata
gccgaagtgccgttcaacgcggagaagctggccgcgctggtggcggccgaccggatggaa
aatccggcgcgctacgcgatggtggtgatttcggaaggcgcgatgatggaaggcggcgag
gcgcagacctatggtcaggcggatgaatatggccgcaagcgcctcggcggtatcggccat
ctgctcggcgaggaactgacgcggctcaccggcgtcgacacgatcacgcagtctctcgcc
tatctcatgcgtgcgggcgcgccggacgcgctcgaccagatggtggcgaagggcttcggc
acgctggcggtgcaggaaattgcggcgggacgcaccggcttcatgacggcggtgcgcgac
ggcaattacacgacggtgccggcatccacatgcgccagcggcggcaagcgcgtcgacgtt
gcgtccttctacgatgcggaggcctatcgcccgcgcattgccgaggtgaagggcaagccg
atgtttttgtattga

DBGET integrated database retrieval system