KEGG   Parvibaculum lavamentivorans: Plav_0677Help
Entry
Plav_0677         CDS       T00580                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00260  Glycine, serine and threonine metabolism
pla00750  Vitamin B6 metabolism
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01120  Microbial metabolism in diverse environments
pla01230  Biosynthesis of amino acids
Module
pla_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plav_0677
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Plav_0677
Enzymes [BR:pla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Plav_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABS62300
JGI: Plav0677
UniProt: A7HQW7
Position
737109..738512
Genome map
AA seq 467 aa AA seqDB search
MKYVSTRGIAPELEFEDALLAGLARDGGLYVPVEWPQLSERKIRALAGLPYEEVAFRVMR
PFIGEAIGDDDLQRMIGEAYASFRHKAIVPLRQLGSNDWLLELFHGPTLAFKDVAMQILA
RLFDHVLAAKGRRVTVVGATSGDTGSAAIEAFKGRDTTDIFILHPKGRVSEVQRRQMTTV
LDANVHNIAIEGSFDDCQALVKAMFNDHGFRDEVSLAGVNSINWGRVMAQIVYFFTAAVA
LGGPARPVAFSVPTGNFGDIFAGYAAARMGLPIEKLIVATNVNDILARTMESGRYEVDKV
VPTISPSMDIQVSSNFERLLFDAYGRDGATVTRLMQSLSQSGAFTIDALRLEAIRAQFGA
ARVDESETSATIKETLAATGELLDPHSAVGLAAAARLRGDPSVPMITLATAHPAKFPDAV
KAATGIHPDLPPAMADIFTREERLAALPNDLGAVETFIRERARSVAA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacgtcagcacaaggggcatcgccccggagcttgaattcgaggatgctttgctc
gcgggtctcgcgcgcgatggcggcctttatgtgcccgtggagtggccgcaactcagcgaa
cgcaagatcagggcgctggcgggactgccctatgaagaggtcgccttccgcgtcatgcgg
ccctttatcggcgaggcgatcggcgatgacgacctgcagcggatgatcggcgaggcctat
gcctcgttccgccacaaggcgattgtgccactgcggcaactcggctcgaacgactggctg
ctcgagctctttcacgggccgacgctcgccttcaaggacgtggcgatgcagattctcgcg
cgcctgttcgaccatgtgctggccgcgaagggccgccgcgtgacggtagtgggcgcgacc
tcgggcgatacgggctcggccgccatcgaagccttcaagggccgcgacacgaccgacatt
ttcatcctgcacccgaagggccgcgtctccgaggtgcagcgccgccagatgacgacggtg
ctggatgcgaacgtccacaacatcgccatcgaaggctcgttcgacgattgccaggcgctg
gtgaaggccatgttcaacgatcatggcttccgcgacgaagtgagccttgctggcgtcaat
tcgatcaactggggccgggtaatggcccagatcgtctattttttcaccgctgccgtggcg
cttggcggccctgcgcggccggtcgccttctcggtgccgacggggaatttcggcgatatt
ttcgccggctatgcggcggcgcggatgggacttccgatcgagaagctgatcgtcgcgacc
aatgtgaacgacatcctcgcgcggacgatggagagcggccgctatgaggtcgacaaggtc
gtgccgacgatcagcccgagcatggacatccaggtctcgtccaatttcgagcggctgctt
ttcgacgcctatgggcgcgatggcgcgaccgtgacgcggctgatgcaaagcctgtcgcaa
tcgggcgctttcaccatcgacgcgctgcgcctcgaagcgatccgcgcccaattcggcgcc
gcccgtgtcgatgaaagcgagacctcggcgaccatcaaggagacgctggcggcgacaggc
gagctgctcgacccgcattcggctgtgggtcttgccgctgcggcaaggttgcggggcgat
ccctcggtgccgatgattacgctggcgacggcgcatcccgcgaagtttcccgatgcggtg
aaggcggcgaccggcatccacccggatctgccgcctgccatggccgatattttcacccgt
gaggaacgcctcgcggcgctgccgaacgatctcggcgcggtcgaaacctttatccgcgaa
cgcgcgcgctccgtcgccgcgtga

DBGET integrated database retrieval system