KEGG   Parvibaculum lavamentivorans: Plav_0677Help
Entry
Plav_0677         CDS       T00580                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Plav_0677
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plav_0677
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Plav_0677
Enzymes [BR:pla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Plav_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
737109..738512
Genome map
AA seq 467 aa AA seqDB search
MKYVSTRGIAPELEFEDALLAGLARDGGLYVPVEWPQLSERKIRALAGLPYEEVAFRVMR
PFIGEAIGDDDLQRMIGEAYASFRHKAIVPLRQLGSNDWLLELFHGPTLAFKDVAMQILA
RLFDHVLAAKGRRVTVVGATSGDTGSAAIEAFKGRDTTDIFILHPKGRVSEVQRRQMTTV
LDANVHNIAIEGSFDDCQALVKAMFNDHGFRDEVSLAGVNSINWGRVMAQIVYFFTAAVA
LGGPARPVAFSVPTGNFGDIFAGYAAARMGLPIEKLIVATNVNDILARTMESGRYEVDKV
VPTISPSMDIQVSSNFERLLFDAYGRDGATVTRLMQSLSQSGAFTIDALRLEAIRAQFGA
ARVDESETSATIKETLAATGELLDPHSAVGLAAAARLRGDPSVPMITLATAHPAKFPDAV
KAATGIHPDLPPAMADIFTREERLAALPNDLGAVETFIRERARSVAA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacgtcagcacaaggggcatcgccccggagcttgaattcgaggatgctttgctc
gcgggtctcgcgcgcgatggcggcctttatgtgcccgtggagtggccgcaactcagcgaa
cgcaagatcagggcgctggcgggactgccctatgaagaggtcgccttccgcgtcatgcgg
ccctttatcggcgaggcgatcggcgatgacgacctgcagcggatgatcggcgaggcctat
gcctcgttccgccacaaggcgattgtgccactgcggcaactcggctcgaacgactggctg
ctcgagctctttcacgggccgacgctcgccttcaaggacgtggcgatgcagattctcgcg
cgcctgttcgaccatgtgctggccgcgaagggccgccgcgtgacggtagtgggcgcgacc
tcgggcgatacgggctcggccgccatcgaagccttcaagggccgcgacacgaccgacatt
ttcatcctgcacccgaagggccgcgtctccgaggtgcagcgccgccagatgacgacggtg
ctggatgcgaacgtccacaacatcgccatcgaaggctcgttcgacgattgccaggcgctg
gtgaaggccatgttcaacgatcatggcttccgcgacgaagtgagccttgctggcgtcaat
tcgatcaactggggccgggtaatggcccagatcgtctattttttcaccgctgccgtggcg
cttggcggccctgcgcggccggtcgccttctcggtgccgacggggaatttcggcgatatt
ttcgccggctatgcggcggcgcggatgggacttccgatcgagaagctgatcgtcgcgacc
aatgtgaacgacatcctcgcgcggacgatggagagcggccgctatgaggtcgacaaggtc
gtgccgacgatcagcccgagcatggacatccaggtctcgtccaatttcgagcggctgctt
ttcgacgcctatgggcgcgatggcgcgaccgtgacgcggctgatgcaaagcctgtcgcaa
tcgggcgctttcaccatcgacgcgctgcgcctcgaagcgatccgcgcccaattcggcgcc
gcccgtgtcgatgaaagcgagacctcggcgaccatcaaggagacgctggcggcgacaggc
gagctgctcgacccgcattcggctgtgggtcttgccgctgcggcaaggttgcggggcgat
ccctcggtgccgatgattacgctggcgacggcgcatcccgcgaagtttcccgatgcggtg
aaggcggcgaccggcatccacccggatctgccgcctgccatggccgatattttcacccgt
gaggaacgcctcgcggcgctgccgaacgatctcggcgcggtcgaaacctttatccgcgaa
cgcgcgcgctccgtcgccgcgtga

DBGET integrated database retrieval system