KEGG   Parvibaculum lavamentivorans: Plav_0816Help
Entry
Plav_0816         CDS       T00580                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00250  Alanine, aspartate and glutamate metabolism
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Plav_0816
Enzymes [BR:pla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Plav_0816
Peptidases [BR:pla01002]
 Cysteine Peptidases
  Family C44
   Plav_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 HPTransfase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ABS62439
JGI: Plav0816
UniProt: A7HRA6
Position
complement(884598..886370)
Genome map
AA seq 590 aa AA seqDB search
MCGFSGEIRFDGVQADARAVMTMCDVLAPRGPDGSGLAASGNVAMGHRRLKIIDLSERGS
QPMTDPALGLTLVFNGCIYNYRELREKLEAKGYSFHSASDTEVVLKAWHAWRADAPTHMN
GMFAFAVHERDSGRTALARDRLGIKPLYLSLSGKRLRFASTLPAILAAGDVDTSIDPQAL
QAYMTWHAVVPPPLTMLKGIRKLPPATVAIFEADGSRRDTVYWSLGYERSREDAMRSEGD
WAEMLHASLIAAVDRRMIADVPVGVLLSGGVDSSLIVGLLAEAGQQSLNTFSIGFEAANG
ELGDEFKYSDIVAKHFGTEHHKIFVPSSELLDALPRTIGSMSEPMVSYDNVGFFLLSQEV
AKHVKVVQSGQGADEVFAGYHWYPKLANSDAPASDYAAAFFDRDFDEYRRTVQPQYHDGH
FVEEFIEDQFSRLGAEHAVDKALRLDTTIMLADDPVKRVDNMTMAWGLEARVPFLDHELV
ELAARIPAQHKLADGGKGILKTVARKVIPADVIDRPKGYFPVPALKYLDGPYLAMVRDAL
STDAAKQRGLFNQGYLEELFANPSEHITPLRGSKLWQIGLLELWLQSHSV
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcttcagcggcgaaataagattcgacggcgtgcaggcggatgcccgtgcggta
atgaccatgtgcgacgtcctcgcaccgagagggccagacggaagcggccttgccgcgagt
ggcaatgtggcaatgggacaccgccggttgaagatcatcgatctcagcgaacgcggcagc
cagccaatgacggatccggcgcttgggctaaccctcgtgttcaatggctgcatctacaat
tatcgtgaattgcgcgagaagctcgaagcgaagggctacagctttcattcggcaagcgac
acggaagtcgtgctgaaggcatggcacgcttggcgcgccgatgcgcccacgcatatgaac
ggcatgttcgccttcgccgtgcacgaacgtgacagcggccgcaccgcgctggcgcgcgac
aggctcggcatcaagccgctttatctctccctcagcggcaaacggctgcgctttgcctcg
acgcttcccgccatattggcggcgggcgatgtcgacacgtcgatcgatccgcaagcactt
caggcttacatgacatggcacgccgtcgtgccgccaccgctgacaatgctgaaaggcatc
cgcaagctgccgccggcgaccgtcgccatattcgaggcagatggcagccgccgggatacc
gtctactggtcactcggctatgagcgctcccgggaagacgcaatgcgcagtgaaggcgat
tgggcggaaatgctgcacgcatcgcttatcgccgccgtcgaccggcgaatgattgccgac
gtacctgtcggggttctgctttcgggtggtgtcgattcaagcttgattgtcggccttctt
gccgaggccggtcagcaatcgctcaatacattctctatcggctttgaagccgcgaatgga
gagctcggcgacgagttcaaatattccgacattgtcgcgaagcacttcggtacggagcat
cacaagattttcgtaccgtcaagcgagctgctcgatgcgctcccccgcaccatcggctcg
atgtcggagcccatggtgtcgtatgacaatgtcggcttctttctgctgtcgcaggaagtc
gcaaagcatgtgaaggtcgtacagagcggccagggcgccgacgaggtttttgccggctat
cactggtacccgaagctcgccaattcagacgcgccggcaagcgattacgcagcggccttt
ttcgaccgcgatttcgacgaatatcgccggacggtccagccgcaatatcacgacggacat
ttcgtcgaagaattcatcgaagatcagttctcccgcctcggcgcagaacacgccgtggac
aaggcattgcgcctcgacaccaccatcatgctcgccgacgatccggtgaagcgtgtggac
aacatgacgatggcttggggacttgaggcgcgcgtcccctttctcgatcatgaacttgtg
gagcttgcggcgcgcatacccgctcagcacaagcttgccgatggcggcaagggcattctg
aagacggtcgcccgcaaagttattcccgccgacgtgatcgaccggccgaagggctacttt
ccggttcccgcgctcaaatatctggatgggccctatctcgccatggtgcgggatgcgttg
agcaccgatgcggcaaagcaacgggggctcttcaatcagggttatctcgaagaactgttc
gccaatccatccgaacacatcacaccgctgcgcggctccaagctctggcagatcggcctt
ctggagctgtggctgcagtcgcattcggtctga

DBGET integrated database retrieval system