KEGG   Parvibaculum lavamentivorans: Plav_0979Help
Entry
Plav_0979         CDS       T00580                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Plav_0979
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Plav_0979
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Plav_0979
Enzymes [BR:pla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Plav_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1057075..1058943)
Genome map
AA seq 622 aa AA seqDB search
MMSFRPTRRDALKGFAATGGVAVMGTSGCSEEPEVIAEFHHGVASGDPEATAVIIWTRVT
APGEASVLWQVAKDEAFAEIVSKGEASAKASSDYTVKIDVRGLEPGQGYFYRFLSGRAVS
PVGRTRTLAAKDATTLRLGVVSCSHYGFGFYNVYRELAKEQDLDAIVHLGDYIYEYGPDG
YGGPEAKEIGREQEPPHEIVTLDDYRMRFSQYRRDADLQAAHAAAPFITIWDDHETANNS
WSGGAQNHQPDTEGKWETRRDAALRAYFEWMPMRDPKPGEAFHRLHRTYEMGTLATLHLI
ETRLTARSGEVSYEDDMVYFETAYDVSDPQAPLVLNAEDAALLPAGRAERLKTPWRESDG
AAITDYKQVREWADTGLPDGYVYKPDLARFREEVLGDPARELLGEAQLGWLAGELKASRA
NEVPWQILGNQVIMARMDAPDFTVAFPPEVIEPAIRDNPYTRQWVERTKLRLPINPGVWD
GYPASRQRLYETVREAEASLVVLTGDSHQFWANDLRETPGGRRIGVEFGTSSVSSKGGYD
YLAADPRAYDITEETLLRDVPEIVYCETRHRGFILLEITAEAVEADYRAVSTVRSRDYTS
SSLKRLRVTREGPGELSDLVPV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgatgagttttcgaccgacacgccgcgatgctctgaagggatttgccgctaccggcggt
gtcgccgtcatgggcacgtccggctgctccgaagagccggaggtcatcgcggaattccac
catggcgttgcgagcggcgacccggaagcgaccgccgtcatcatctggacccgcgtcacc
gctccgggcgaggcgagcgttctctggcaagtggcaaaggacgaggcatttgccgagatc
gtgagcaagggcgaggcctccgcgaaggcctccagcgactatacggtgaagatcgatgtg
cgcggccttgagcccggccaaggttatttctaccgctttctctcgggcagggctgtctct
ccggtcggccgcacccgcactctcgccgcaaaggatgcaacgacgctccgtctcggtgtc
gtctcctgctcgcattacggcttcggcttctacaacgtctatcgcgaactcgcgaaggag
caggacctcgacgccatcgtccaccttggcgactacatctacgaatacggacctgatggt
tatggcggacccgaggcaaaggagattggccgcgagcaggagccaccgcacgagatcgtg
acactcgacgattaccgcatgcgtttttcccagtatcgccgcgatgccgaccttcaggcc
gcgcatgcggccgcgcctttcatcaccatttgggacgaccatgaaacggcgaataattca
tggtcgggcggcgcccagaaccatcagccggacaccgaaggcaagtgggagacaaggcgg
gatgcggcgctccgcgcctatttcgaatggatgcccatgcgcgacccgaaaccgggagaa
gctttccatcgtctccatcggacctacgagatggggacgcttgcgacactccatctcatt
gagacgagactcaccgcccgcagcggcgaggtgagctatgaagacgacatggtctatttc
gagaccgcctatgatgtttcggacccgcaagcgccgctcgtcctgaacgccgaagatgcc
gccttgcttccggcaggccgggccgaacgcctgaaaacaccttggcgtgaaagcgacggc
gccgcgatcacagattacaagcaagtccgcgaatgggccgataccggcctgccggacgga
tacgtctacaagcccgacctcgcgcgctttcgcgaggaagttctgggagatcccgcccgc
gaactgctcggtgaggcacaattgggatggctcgcgggcgagttgaaggcatcgcgcgcg
aatgaggtgccgtggcagatcctcggcaaccaggtcatcatggcgcgcatggatgcgccg
gacttcacggtggccttcccacccgaggtgatcgagcccgcgatacgggacaacccctat
acccgtcaatgggtggagcgcacgaagctccgcctgcccatcaatcccggcgtatgggac
ggctatcctgcctcgcgtcagcgcctgtatgaaacggtgcgcgaagcggaagcaagtctc
gtcgtgctgacgggcgactcgcatcagttctgggcgaacgatcttcgcgagacgccgggc
ggcaggcgcatcggcgtcgaattcggtaccagcagcgtcagttcaaagggcggttacgac
tatctcgccgccgacccgcgcgcctatgacatcaccgaggagacgctgctgcgcgatgtg
cccgagatcgtctattgcgagacgcgtcacaggggtttcatcctgctcgaaattaccgca
gaagctgtcgaggcggattacagggccgtttcgaccgttcgctcccgcgactacacatcg
tcgagcctcaagcggcttcgcgtcacccgcgaagggccgggcgagctttcggatctcgtc
ccggtttga

DBGET integrated database retrieval system