KEGG   Parvibaculum lavamentivorans: Plav_1053Help
Entry
Plav_1053         CDS       T00580                                 

Definition
phosphoglucomutase/phosphomannomutase subunit alpha/beta
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plav_1053
   00030 Pentose phosphate pathway
    Plav_1053
   00051 Fructose and mannose metabolism
    Plav_1053
   00052 Galactose metabolism
    Plav_1053
   00500 Starch and sucrose metabolism
    Plav_1053
   00520 Amino sugar and nucleotide sugar metabolism
    Plav_1053
  Nucleotide metabolism
   00230 Purine metabolism
    Plav_1053
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Plav_1053
Enzymes [BR:pla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Plav_1053
    5.4.2.8  phosphomannomutase
     Plav_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1157910..1159409)
Genome map
AA seq 499 aa AA seqDB search
MPLKPRADLKPNTLEFENLPLVSPNGFREYDARWLFEKEINLVGVQALGLGLGTLIQEMG
VAPRITVGHDFRSYSASIKQALIIGLMNAGCEVHDIGLALSPVAYFSQFALDVPCVAMVT
ASHNENGWTGVKMGAQRPLTFGPDEMTRLKEIVLSGGGKERDGGRYIRVEDMRERYIADL
TDRPKIKRKLRVVAACGNGTAGAFAPKVLEGIGVEVIPLDCELDYTFPRYNPNPEDMEML
HALRDKVLETGADVGLGFDGDGDRCGVVDDTGEEIFADKVGVMLARDLSSRHANAQFVVD
VKSTGLFLTDPVLIANGAKTDYWKTGHSYIKRRAHELNALVGFEKSGHYFFNPPIGRGYD
DGLVSAIAICDMLDRNPAKKMSELREDLPKTWGSPTMSPYCPDEKKYEVVERMVKLFSGM
ADKGEKLLGQKIRDVVTVNGVRVTTEDGTWGLVRASSNKPGLVVVVESPASEANMRAMFA
EIDGHLSAQPEVGEYDQKI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgaagccccgcgccgacctgaagcccaacacgctcgaattcgagaacctgccc
ctcgtttcccctaacgggtttcgcgaatatgacgcgcggtggctgttcgagaaggaaatc
aatctcgtcggcgtgcaggcgctggggctggggctcggcacgctgatccaggagatgggc
gtggcgccgcgcattacggtcggacatgatttccgctcctattccgcgtcgatcaagcag
gcactcatcatcgggctgatgaatgccggctgcgaggtgcatgatatcgggctcgcgctt
tcgcccgtcgcctatttctcgcaattcgcgctcgatgtgccctgcgtcgccatggtgaca
gcgagccacaacgagaatggctggaccggcgtgaagatgggcgcgcagcggccactcacc
ttcggacccgacgagatgacgcggctgaaggagatcgtgctttcgggcggcggcaaggag
cgcgacggcgggcgctatatccgcgtcgaagacatgcgggaacgctatatcgccgacctc
acggaccggccgaagatcaaacggaagctgcgcgttgtggcggcctgcggcaacggcacg
gcgggcgcctttgcgccgaaggttctcgaaggcataggcgtcgaggtgatcccgctcgat
tgcgagctggactataccttcccgcgatataatccgaacccggaagacatggagatgctc
catgcgctgcgcgacaaggtgctggagacgggtgccgatgtgggcctcggtttcgacggc
gatggcgaccgctgcggcgtggtggacgatacgggcgaggaaatcttcgccgacaaggtg
ggcgtgatgctcgcgcgcgatctttcctcgcggcatgcgaatgcgcagttcgtggtcgat
gtgaaatcgacggggctcttcctcaccgaccctgtattgatcgccaacggtgcgaagacg
gattactggaagacgggacactcctatatcaagcggcgcgcgcatgagctgaatgctctc
gtcggcttcgagaagtcgggccactacttcttcaatccgccgatcgggcgcggctatgat
gacgggctcgtctcggccattgcgatttgcgacatgctggaccggaacccggcgaagaag
atgtccgagctgcgcgaggacctgccgaagacatggggctcgcccaccatgtcgccctac
tgccccgacgagaaaaaatatgaagtcgtcgagcggatggtgaagctcttttccggcatg
gccgacaagggcgaaaaacttctcggccagaaaatccgcgatgtcgtgacggtgaacggc
gtgcgcgtgacgacggaagacgggacgtggggacttgtccgcgcatcgtcgaacaagccg
gggcttgtggtcgtggtggaaagcccggcgtcggaagcgaacatgcgggccatgttcgcc
gagatcgacggacatctttccgcgcagccggaagtgggcgagtacgaccagaagatctag

DBGET integrated database retrieval system