KEGG   Parvibaculum lavamentivorans: Plav_1138Help
Entry
Plav_1138         CDS       T00580                                 

Definition
limonene-12-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:pla00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1254809..1255213
Genome map
AA seq 134 aa AA seqDB search
MNTTTMMTAEASKKLVADFLGAWQKRDIPGIMDCFAPDAVYHNVPVAPIKGIAGIRKIFE
DFLAAFAYADLEIIRICAEPNLVFAERVDHFRLHDGRSVDLPVNGVFELRDGKIWRFSDY
FDLASFEGPTGLKL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaccacgatgatgacggctgaagcctcgaaaaagctggtcgccgattttctc
ggcgcctggcagaagcgcgacatccccggcatcatggattgcttcgcgcccgatgccgtc
tatcacaatgttccggtcgcgccgatcaagggcatcgccggtatccgcaagatcttcgag
gatttcctcgcggccttcgcatatgccgatctcgaaatcatccgcatctgcgctgaacca
aacctcgtcttcgccgaacgtgtcgatcatttccgccttcatgacggcaggagcgtcgac
ctgccggtgaatggcgtcttcgaactgcgagatggcaagatctggcgtttcagcgactat
ttcgatctcgcctcctttgaaggccccaccggcttgaagctctga

DBGET integrated database retrieval system