KEGG   Parvibaculum lavamentivorans: Plav_1138Help
Entry
Plav_1138         CDS       T00580                                 

Definition
limonene-12-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Plav_1138
Enzymes [BR:pla01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Plav_1138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1254809..1255213
Genome map
AA seq 134 aa AA seqDB search
MNTTTMMTAEASKKLVADFLGAWQKRDIPGIMDCFAPDAVYHNVPVAPIKGIAGIRKIFE
DFLAAFAYADLEIIRICAEPNLVFAERVDHFRLHDGRSVDLPVNGVFELRDGKIWRFSDY
FDLASFEGPTGLKL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaccacgatgatgacggctgaagcctcgaaaaagctggtcgccgattttctc
ggcgcctggcagaagcgcgacatccccggcatcatggattgcttcgcgcccgatgccgtc
tatcacaatgttccggtcgcgccgatcaagggcatcgccggtatccgcaagatcttcgag
gatttcctcgcggccttcgcatatgccgatctcgaaatcatccgcatctgcgctgaacca
aacctcgtcttcgccgaacgtgtcgatcatttccgccttcatgacggcaggagcgtcgac
ctgccggtgaatggcgtcttcgaactgcgagatggcaagatctggcgtttcagcgactat
ttcgatctcgcctcctttgaaggccccaccggcttgaagctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system