KEGG   Parvibaculum lavamentivorans: Plav_1331Help
Entry
Plav_1331         CDS       T00580                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00010  Glycolysis / Gluconeogenesis
pla00620  Pyruvate metabolism
pla00640  Propanoate metabolism
pla00680  Methane metabolism
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01120  Microbial metabolism in diverse environments
pla01130  Biosynthesis of antibiotics
pla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plav_1331
   00620 Pyruvate metabolism
    Plav_1331
   00640 Propanoate metabolism
    Plav_1331
  Energy metabolism
   00680 Methane metabolism
    Plav_1331
Enzymes [BR:pla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Plav_1331
Lipid biosynthesis proteins [BR:pla01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Plav_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABS62951
JGI: Plav1331
UniProt: A7HSR8
Position
complement(1466246..1468189)
Genome map
AA seq 647 aa AA seqDB search
MSDEIFPVPAEWKKRAIVDAEKYRHMYEASINDPESFWRREGLRIDWMKPYTKIKDTSFD
PHNVSIKWFEDGTLNASVNCIDRHLERRAGQVAIIWEGDDPSIDRKITYRELHDEVCRFA
NVLKARGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPDSLAGRIVDCASS
CVITADEGVRGGRKIPLKANTDEALKKCPGVKSVIVVKHTGGAVAMEKGRDVWYAEEAAK
VSATCAPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYMVYASMTHQYVFDYHDGDIYWC
TADVGWVTGHSYILYGPLANGATTLMFEGVPNYPDASRCWQVIDKHEVNIFYTAPTALRA
LMREGEEPVKKTSRKSLRLLGSVGEPINPEAWLWYHRVVGDGRCPIVDTWWQTETGGILI
SPLPGAIATKPGSATKPFFGVQPVIVDAEGNVQEGATTGNLCIDDSWPGQMRTVYGDHQR
FVETYFIQYPGRYFTGDGCRRDEDGYYWITGRVDDVLNVSGHRMGTAEVESALVAHPKVA
EAAVVGYPHDIKGQGIYAYVTLIAGEAATEELRKELVTWVRKEIGPIASPDLIQFAPGLP
KTRSGKIMRRILRKIAEDDFSNLGDTSTLADPSVVTDLVDNRQNKAG
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgaaatttttcccgttcccgccgaatggaagaagcgcgccatcgtggatgcg
gagaaataccgccacatgtatgaggcaagcatcaacgacccggaaagcttctggcggcgc
gagggactgcgcatcgactggatgaagccctatacgaagatcaaggacacgagcttcgac
ccgcataatgtctcgatcaaatggttcgaggacgggacgctcaacgcaagcgtgaactgc
atcgaccggcacctcgaacgccgcgccggccaggtggcgatcatctgggaaggcgacgat
ccctccatcgaccggaagatcacctatcgcgagcttcacgacgaggtctgccgcttcgcc
aatgtgcttaaagcacgcggcgtgaagaagggcgaccgcgtcacgatctacatgccgatg
atcccggaagcggcctatgcgatgctcgcctgcgcgcggatcggcgcggtgcattcggtg
gtctttggcggcttctcgccggacagcctggcggggcgcattgtggactgcgcttccagc
tgcgtcatcacggcggatgaaggcgtgcgcggcggaaggaaaattccgctgaaagccaat
accgacgaggcgctgaagaaatgccccggcgtcaaaagcgtgatcgtcgtgaagcatacc
ggcggcgccgtcgccatggagaaaggacgcgacgtctggtacgcagaagaagcggcgaag
gtttccgccacctgcgcgccggaagagatgaacgcggaagacccgctttttattctgtat
acgtccggttcgaccggaaagccaaaaggcgtgctgcacacgaccggcggctacatggtc
tatgcgtcgatgacgcatcaatatgtcttcgactatcacgacggcgacatttactggtgc
acggcggatgtcggctgggtgacgggccacagctacatcctctacgggccgctggcgaac
ggcgcgacgacgctgatgttcgagggcgtgccgaactatcccgacgcctcgcgctgctgg
caggtgatcgacaagcatgaagtgaatattttctacaccgcgccgaccgcccttcgtgca
ttgatgcgcgaaggcgaggagccggtgaagaagacgagccgcaaatcgctgcggctcctc
ggctccgtcggcgaaccgatcaacccggaagcctggctctggtatcaccgcgtggtgggc
gacgggcgctgcccgatcgtcgatacatggtggcagacggaaaccggcggcatattgatc
tcgccgctgcccggcgccatcgcgacgaagccgggctcggcaacgaagcctttcttcggc
gtgcagccggtgatcgtggacgcggaaggaaacgtgcaggaaggcgcgacgaccggcaat
ctctgcatcgacgatagctggcccggccagatgcgcaccgtctatggcgatcatcagcgc
ttcgtcgaaacctatttcatccagtatcccggccgctacttcaccggcgatggctgccgc
cgcgacgaggacggctattactggatcaccggccgcgtcgacgacgtgctgaacgtctcg
ggccatcgcatgggaacggcggaagtcgaaagcgcgctggtcgcgcatccgaaagtcgcg
gaagccgccgtggtcggctatccgcacgacatcaagggccagggcatctatgcctatgtg
acgctgatcgcgggcgaggcggcgacggaagagttgcggaaggaactggtgacctgggtg
cggaaagagatcggcccgatcgcctcgccggacctcatccagttcgcgcccggcctgccg
aaaacgcgctccggcaagatcatgcgccgcatcttgcgcaagatcgccgaggacgacttc
tccaatctcggcgacacctcgacactggccgacccctccgtcgtcaccgacctcgtggac
aaccggcagaacaaggcggggtag

DBGET integrated database retrieval system