KEGG   Parvibaculum lavamentivorans: Plav_1392Help
Entry
Plav_1392         CDS       T00580                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Plav_1392
Enzymes [BR:pla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Plav_1392
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Plav_1392
Lipid biosynthesis proteins [BR:pla01004]
 Fatty acid synthase
  Component type
   Plav_1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1522101..1522781)
Genome map
AA seq 226 aa AA seqDB search
MRYGLPAPFCKLFASLAFVLVLVSAPVAQASEKAPITIVALGDSLTAGYLLGPDEGFAER
LDRALKEAGHENVNVSNAGVSGDTTSGGLARLDWAVGPEADAVIVELGANDALRGLDPAL
ARDNLAEIVARLKERGLPILLAGMLAPPNLGSDYGAEFNPIYPELAEKEDLILYPFFLDG
VAGDRRLNLSDGIHPTAEGIEIIVERIMPKVEELIARVEEERRAGE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatggccttccggcccccttttgcaagctcttcgcgagcctggcctttgtgctg
gtgcttgtctccgcgcccgttgcgcaggcctcggagaaggcgcccatcaccatcgttgcg
ctgggcgatagcctgacagcaggctatctgctgggtccggacgaaggttttgccgaaagg
ctggaccgggcgctgaaggaagccggtcacgagaatgtgaatgtatcgaacgcaggcgtt
tccggcgacacgacatcgggcggccttgcgcggctcgactgggcggtgggcccggaggcg
gatgcggtgatcgtcgaactgggcgcgaacgacgcgctgcgcgggctcgaccccgccctt
gcgcgcgacaaccttgccgagatcgtggcgcggctgaaggaacgcggcctgcccatcctg
cttgccggcatgctggcgccgcccaatctcggcagcgactatggcgccgagttcaacccg
atctatcccgagcttgcggagaaggaagacctgatcctctatcccttctttctcgacggc
gtggccggcgaccgcaggctcaacctcagcgacggcatccacccgacggcggaaggcatc
gagatcatcgtggagcggatcatgccgaaagtggaagagctgatcgcgcgggtggaggag
gagcggcgcgcgggggagtga

DBGET integrated database retrieval system