KEGG   Parvibaculum lavamentivorans: Plav_1425Help
Entry
Plav_1425         CDS       T00580                                 

Definition
3-isopropylmalate dehydrogenase
Orthology
K00052  
3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Plav_1425
   01230 Biosynthesis of amino acids
    Plav_1425
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Plav_1425
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Plav_1425
Enzymes [BR:pla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     Plav_1425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1555843..1556949
Genome map
AA seq 368 aa AA seqDB search
MTRNILIVAGDGIGPEVMGEVERVIGWFNDNRKFDAKIENELVGGCCYDAHGVAVTDETV
EKAKRADAVMLGAVGGPKWDNVPYEGRPEAGLLRLRKDLELFANLRPALCFAALADASSL
KREIVEGLDIMIVRELTGGVYFGEPKEITDLGNGERRGVDTQVYTTSEIRRIAEVAFDLA
KKRDNRVMSVEKRNVMKSGVLWYEEVKTLHGEKFSDVKLEHMLADNCAMQLVRNPKQFDV
IVTDNLFGDVLSDIASMLTGSLGMLPSASLGAKDASGKACAMYEPVHGSAPDIAGTGAAN
PIASILSFAMALRYTFELGADADLLEKAVDKVLADGLRTGDIMQPGMKKVGTKEMGDAIL
AALAKLNG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaaacatcctcatcgtcgccggcgacggcatcggcccggaagtcatgggcgaa
gtcgagcgcgtgatcggctggttcaacgacaatcgcaagttcgacgcgaagatcgaaaac
gagcttgtcggcggctgctgctacgacgcgcatggcgtcgcggtgacggacgagacggtc
gagaaggcgaagcgcgcggatgccgtcatgctcggcgcggtgggcgggccgaaatgggat
aacgtgccttacgagggccgcccggaagccggcctgctgcggctgcgcaaggatctcgaa
ctcttcgcgaaccttcgtcccgcgctctgcttcgcggcgctcgcggacgcatcctcgctg
aagcgcgagatcgtcgagggcctcgacatcatgatcgtgcgcgagctcaccggcggcgtc
tatttcggcgagccgaaggaaatcaccgatctcggcaatggcgagcggcgcggcgtcgac
acgcaggtctatacgacgagcgaaatccgccgtattgcggaagtcgccttcgatctcgcg
aagaagcgcgacaatcgcgtcatgtcggtcgagaagcgcaacgtgatgaagtccggcgtc
ctctggtacgaggaagtgaagacgctccacggtgagaagttctccgacgtgaagctcgag
cacatgctggccgacaattgcgccatgcagctcgtgcgcaatccgaagcagttcgacgtg
atcgtcaccgacaatctcttcggcgacgtcctctccgacatcgcctccatgctcacgggc
tcgctcggcatgctgccttccgcctcgctcggcgcgaaggatgcgagcggcaaggcctgc
gccatgtatgagccggtgcatggctccgcgcccgacatcgcgggcacgggcgcggccaat
cccatcgcctcgatcctcagcttcgccatggcgcttcgttacacgttcgagctcggcgcc
gatgccgacctgctcgaaaaagcggtcgacaaggtgctcgccgacgggctccgcaccggc
gacatcatgcagccgggcatgaagaaagtcggcacaaaggaaatgggcgacgccatcctc
gccgccctcgcgaaactgaacggatag

DBGET integrated database retrieval system