KEGG   Parvibaculum lavamentivorans: Plav_1434Help
Entry
Plav_1434         CDS       T00580                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pla  Parvibaculum lavamentivorans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plav_1434
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plav_1434
   00650 Butanoate metabolism
    Plav_1434
  Energy metabolism
   00190 Oxidative phosphorylation
    Plav_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1564634..1565059
Genome map
AA seq 141 aa AA seqDB search
MADTHKTASAATKPANDMRTPLARVLHLGSAKSGTQDHIRQRLTAVAIAPLSLFFLVLLV
ALTGADYETARSWLANPLVGILALCLIVAAIIHMRIGMQIVIEDYVIAPGLKHLSILANT
FFSYGVGLACLYAVLKLAFGS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggccgacactcacaagacggcgtccgccgcaacgaagcccgcaaacgacatgcgcaca
ccgcttgcccgcgtgcttcatctcgggtcggcgaaatccggcacgcaggatcacatccgc
cagcgtctcaccgctgtcgccattgcgccgctctcgctctttttcctcgtgctcctcgtc
gcgcttaccggcgccgattacgagacggcgcggagctggctcgccaatccgcttgtcggc
atcctcgcgctctgcctcatcgtcgccgccatcatccatatgcgcatcggcatgcagatc
gtgatcgaggattatgtgatcgcccccgggctcaagcatctcagcatcctcgccaacacc
ttcttctcctatggcgtcggccttgcctgcctctatgcggtgctgaagctcgccttcggt
tcctga

DBGET integrated database retrieval system