KEGG   Parvibaculum lavamentivorans: Plav_1452Help
Entry
Plav_1452         CDS       T00580                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00020  Citrate cycle (TCA cycle)
pla00640  Propanoate metabolism
pla00660  C5-Branched dibasic acid metabolism
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01120  Microbial metabolism in diverse environments
pla01130  Biosynthesis of antibiotics
pla01200  Carbon metabolism
Module
pla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plav_1452
   00640 Propanoate metabolism
    Plav_1452
   00660 C5-Branched dibasic acid metabolism
    Plav_1452
Enzymes [BR:pla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Plav_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABS63072
JGI: Plav1452
UniProt: A7HT39
Position
1580553..1581722
Genome map
AA seq 389 aa AA seqDB search
MNIHEYQAKAVLAKYGVPVPSGHAAFTPEEAVAKAKELGGPVWVVKAQIHAGGRGKAGGV
KVVKSLDDVKKEATRLIGSTLVTHQTGPDGKEVNRLYIEDGSSISRELYLSILVDRATSR
VSFIVSTEGGMDIEEVAKKTPEKILSFSVDPASGISGFHGRKVAYALGLEGDQVKQGVAL
IEKLYKAFVTEDMSMLEINPLVVTGEGNLLCLDAKVNFDSNALYRHKDIVELRDLTEEDP
AEVEASKYDLNYIKLDGKIGCMVNGAGLAMATMDIIKLYGSEPANFLDVGGGATKEKVTA
AFKIILSDPSVEGILVNIFGGIMRCDIIAEGVIAAAKEVSLSVPLVVRLEGTNVDLGKKI
MAESGLPIISADNLADAAEKIVKAVKEAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgaataccaggccaaggccgtgctcgcgaagtatggcgtgccggtgccc
agcggccatgcggccttcacgcctgaggaagcggtcgcgaaagcgaaagaactcggcggg
ccggtctgggtcgtcaaggcgcagatccatgcaggcggccgcggcaaggccggcggcgtc
aaggtcgtgaagtcgctcgacgatgtgaagaaggaagcgacacggctgatcggctcgacg
ctcgtcacgcatcagacgggccccgacggcaaggaagtgaaccgcctctatatcgaggac
ggctcctccatctcccgcgagctttacctctccattctcgtcgatcgcgccacctcgcgc
gtctcgttcatcgtctcgaccgaaggcggcatggatatcgaggaagtggcgaagaagacg
ccggaaaaaattctcagcttctcggttgatcccgcctccggcatcagcggctttcacggc
cgcaaggtcgcctatgcgctcggccttgaaggcgaccaggtgaagcagggcgtcgccctc
atcgaaaagctctacaaggccttcgtcaccgaagacatgagcatgctcgagatcaatccg
ctcgtcgtcactggcgagggcaatctgctctgcctcgacgccaaggtaaacttcgattcg
aacgcgctctaccgtcacaaggacattgtcgagctgcgcgacctcacggaagaagatcct
gccgaggtcgaagcgtcgaaatacgacctcaactacatcaagctcgacggcaagatcggc
tgcatggtcaacggcgccggtctcgccatggcgaccatggacatcatcaagctttatggc
tccgagcccgcgaacttcctcgatgtcggcggcggcgcgacgaaggagaaggtcacggcg
gccttcaagatcattctgtcggatccgagcgtcgaaggcattctcgtcaacatcttcggc
ggcatcatgcgttgcgacatcattgccgagggcgtcatcgccgcggcgaaggaagtctcg
ctcagcgtgccgctcgtcgtgcgcctcgaaggcacgaatgtcgatctcggcaagaagatc
atggccgagagcggcctgcccatcatttcagcggacaacctcgccgatgcggccgagaaa
atcgtcaaagccgtgaaggaggccgcataa

DBGET integrated database retrieval system