KEGG   Parvibaculum lavamentivorans: Plav_1452Help
Entry
Plav_1452         CDS       T00580                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plav_1452
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plav_1452
   00640 Propanoate metabolism
    Plav_1452
   00660 C5-Branched dibasic acid metabolism
    Plav_1452
Enzymes [BR:pla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Plav_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1580553..1581722
Genome map
AA seq 389 aa AA seqDB search
MNIHEYQAKAVLAKYGVPVPSGHAAFTPEEAVAKAKELGGPVWVVKAQIHAGGRGKAGGV
KVVKSLDDVKKEATRLIGSTLVTHQTGPDGKEVNRLYIEDGSSISRELYLSILVDRATSR
VSFIVSTEGGMDIEEVAKKTPEKILSFSVDPASGISGFHGRKVAYALGLEGDQVKQGVAL
IEKLYKAFVTEDMSMLEINPLVVTGEGNLLCLDAKVNFDSNALYRHKDIVELRDLTEEDP
AEVEASKYDLNYIKLDGKIGCMVNGAGLAMATMDIIKLYGSEPANFLDVGGGATKEKVTA
AFKIILSDPSVEGILVNIFGGIMRCDIIAEGVIAAAKEVSLSVPLVVRLEGTNVDLGKKI
MAESGLPIISADNLADAAEKIVKAVKEAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgaataccaggccaaggccgtgctcgcgaagtatggcgtgccggtgccc
agcggccatgcggccttcacgcctgaggaagcggtcgcgaaagcgaaagaactcggcggg
ccggtctgggtcgtcaaggcgcagatccatgcaggcggccgcggcaaggccggcggcgtc
aaggtcgtgaagtcgctcgacgatgtgaagaaggaagcgacacggctgatcggctcgacg
ctcgtcacgcatcagacgggccccgacggcaaggaagtgaaccgcctctatatcgaggac
ggctcctccatctcccgcgagctttacctctccattctcgtcgatcgcgccacctcgcgc
gtctcgttcatcgtctcgaccgaaggcggcatggatatcgaggaagtggcgaagaagacg
ccggaaaaaattctcagcttctcggttgatcccgcctccggcatcagcggctttcacggc
cgcaaggtcgcctatgcgctcggccttgaaggcgaccaggtgaagcagggcgtcgccctc
atcgaaaagctctacaaggccttcgtcaccgaagacatgagcatgctcgagatcaatccg
ctcgtcgtcactggcgagggcaatctgctctgcctcgacgccaaggtaaacttcgattcg
aacgcgctctaccgtcacaaggacattgtcgagctgcgcgacctcacggaagaagatcct
gccgaggtcgaagcgtcgaaatacgacctcaactacatcaagctcgacggcaagatcggc
tgcatggtcaacggcgccggtctcgccatggcgaccatggacatcatcaagctttatggc
tccgagcccgcgaacttcctcgatgtcggcggcggcgcgacgaaggagaaggtcacggcg
gccttcaagatcattctgtcggatccgagcgtcgaaggcattctcgtcaacatcttcggc
ggcatcatgcgttgcgacatcattgccgagggcgtcatcgccgcggcgaaggaagtctcg
ctcagcgtgccgctcgtcgtgcgcctcgaaggcacgaatgtcgatctcggcaagaagatc
atggccgagagcggcctgcccatcatttcagcggacaacctcgccgatgcggccgagaaa
atcgtcaaagccgtgaaggaggccgcataa

DBGET integrated database retrieval system