KEGG   Parvibaculum lavamentivorans: Plav_1455Help
Entry
Plav_1455         CDS       T00580                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plav_1455
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plav_1455
  Amino acid metabolism
   00310 Lysine degradation
    Plav_1455
Enzymes [BR:pla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Plav_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1586079..1587320
Genome map
AA seq 413 aa AA seqDB search
MATEIRVPTLGESVTEATVAKWFKKPGDSVAVDEPLVELETDKVTVEVPAPAAGVLSEIV
AADGETVEVGALLGAIGEGGAKAAAPAAKKEEPKKAEAKPEPKKEEPKKQEAKEPAKPAD
AEPSPAVRRVAAENDLDVSKVEGTGKGGRVTKADAEEAASGKAEAKPSAPVQAPAARADN
GAREERVKMTRLRKTIATRLKEAQNTAAMLTTFNEVDMTNVMALRTQYKDLFEKKHGVRV
GFMGFFVKACIHALRELPAVNAEIDGEELVYKNYYNIGVAVGTDRGLVVPVLRDAQDLSL
AEIEKAINNLGRRARDGDLKLDDLQGGTFTISNGGVYGSLMSTPILNAPQSGILGMHKIQ
ERPMVVGGKIEIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPQRLLLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggaaattcgcgtgcccacgctgggcgagtcggtgacggaggccactgtcgcg
aaatggttcaagaagccgggcgacagcgtggccgtggacgagccgctggtcgagcttgaa
acagacaaggtaacggtcgaagtgccggcgcctgccgccggtgtcctgtctgaaatcgtc
gcggccgatggcgagacggtcgaggtcggcgcgctgctcggcgcgatcggcgaaggtggt
gcgaaagccgccgcgcccgccgcgaagaaggaagaaccgaaaaaggccgaggcgaagccg
gagccgaaaaaggaagagccgaaaaagcaggaagcgaaggagccggcaaagcctgccgat
gccgaaccttcgcccgccgtccgccgcgtcgccgccgaaaacgatctcgatgtttcgaag
gtcgaaggcaccggcaagggcggccgcgtgacaaaggccgatgccgaggaagccgcatcc
ggcaaggccgaagcgaagccctccgcccccgttcaggcgcccgccgcgcgggcggataat
ggcgcccgcgaagagcgagtgaagatgacgcggctccgcaagaccattgcgacgcgcctc
aaggaagcacagaacaccgccgccatgctcaccaccttcaacgaggtggacatgacgaac
gtcatggcgctccgcacgcaatacaaggatctcttcgagaagaagcatggcgtgcgtgtc
ggcttcatgggcttcttcgtcaaggcctgcatccatgcgctgcgcgagcttccggccgtc
aatgccgagatcgacggcgaggaactcgtctacaagaattactacaatatcggcgttgcc
gtcggcacggatcgcggccttgtcgtgccggtgctgcgcgacgcgcaggacctttcgctc
gccgaaatcgaaaaggcgatcaacaatctcggacggcgtgcccgcgatggcgacctgaag
ctcgacgatttgcagggtggcaccttcaccatctcgaatggcggcgtctatggctcgctc
atgtcgacgccgatcctcaacgcgccgcagtccggcattctcggcatgcacaagatccag
gagcggccgatggtcgtcggcggcaagatcgaaatccgcccgatgatgtatctcgcgctc
tcctacgatcaccgcatcgtcgacggcaaggaagcggtcaccttcctcgtccgcgtgaag
gaatcgctggaagatccgcaacgtctcctgctcgacctctga

DBGET integrated database retrieval system