KEGG   Parvibaculum lavamentivorans: Plav_1479Help
Entry
Plav_1479         CDS       T00580                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00330  Arginine and proline metabolism
pla00332  Carbapenem biosynthesis
pla01100  Metabolic pathways
pla01130  Biosynthesis of antibiotics
pla01230  Biosynthesis of amino acids
Module
pla_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Plav_1479
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Plav_1479
Enzymes [BR:pla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Plav_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABS63099
JGI: Plav1479
UniProt: A7HT66
Position
complement(1612622..1613779)
Genome map
AA seq 385 aa AA seqDB search
MSAQSTGASLATAQRVVVKIGSALLTDPETGKLNRTWLQALVEDVARMQSRGQEMLIVSS
GAIALGRRALKLPPGKLKLEESQAAAAVGQIGLAHAFQEILSAYGFSCAQILVTLEDTEE
RRRYLNARSTISTLLKFRAVPVINENDTVATSEIRYGDNDRLAARVASMVSADCLILLSD
VDGLYTAPPHLPGARHLAEVAEITPEIEAMAGDAASEFSRGGMKTKIAAARIATESGARM
AIANGRGLHPLKALEEGARCTWFAAHSTPVAARKRWISGSLKTLGTILIDDGAVRALTQG
RSLLPAGVTGVEGEFGRGDAVSVRDGAGVEIASGLSAYSSGDARAIMGHSSHEIEELLGY
SGRAEMIHRDDLVLKRAEIRERDPH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcaatcgacgggtgcatctctcgctaccgcgcaacgcgttgtcgttaaaatc
ggctcagcgctgctgaccgatcccgaaacgggcaagctgaaccgcacctggctgcaggca
ctggtggaagacgtggcgcggatgcaatcgcgcggacaggaaatgctgatcgtttcctcc
ggcgcgatcgcgctcggccggcgcgcattgaagctcccgcccggcaagctgaagctggag
gaaagccaggccgccgccgccgtgggccagatcggccttgcccatgcctttcaggaaata
ctttccgcctatggcttctcttgcgcgcagatccttgtgacgcttgaagatacggaagaa
cgccgccgctacctcaacgcgcgttcgacgatttccacactgctgaaattccgcgccgtt
ccggtcatcaatgagaacgacacggtcgcaacgagcgaaatccgctatggcgataatgac
cgcctcgcggcacgcgtcgccagcatggtttcggccgattgcctgatccttctgtcggat
gtcgacgggctctacaccgccccgccccatcttcccggcgcgcgccacctcgccgaagtg
gccgagatcacgccggagatcgaagcgatggcgggcgatgcggcgagcgaattttcacgg
ggcggcatgaagaccaagattgccgccgctcgcatcgcgaccgaatccggcgcacgcatg
gcgatcgcgaacggacgcggcctgcatcccctcaaagcattggaggaaggcgcgcgctgc
acctggttcgccgcgcattcgacgccggtggccgcccgaaagcgctggatatccgggtcg
ctgaagacgctcggcaccattttgatcgacgacggcgcggtgcgggctctcactcagggc
cgaagcttgcttcccgccggcgtaacaggcgtcgagggcgagttcggccgcggcgacgcc
gtcagcgtgcgcgacggcgcgggcgtcgaaatcgcgagcggtctcagcgcctattcgagc
ggggacgcgcgggccatcatgggccattcgagccacgaaatagaggaactgctcggctat
tcgggccgcgcggaaatgatccatcgcgacgatctggtacttaaaagggctgaaattcgc
gagcgcgatccccattaa

DBGET integrated database retrieval system