KEGG   Parvibaculum lavamentivorans: Plav_1479Help
Entry
Plav_1479         CDS       T00580                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pla01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pla00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1612622..1613779)
Genome map
AA seq 385 aa AA seqDB search
MSAQSTGASLATAQRVVVKIGSALLTDPETGKLNRTWLQALVEDVARMQSRGQEMLIVSS
GAIALGRRALKLPPGKLKLEESQAAAAVGQIGLAHAFQEILSAYGFSCAQILVTLEDTEE
RRRYLNARSTISTLLKFRAVPVINENDTVATSEIRYGDNDRLAARVASMVSADCLILLSD
VDGLYTAPPHLPGARHLAEVAEITPEIEAMAGDAASEFSRGGMKTKIAAARIATESGARM
AIANGRGLHPLKALEEGARCTWFAAHSTPVAARKRWISGSLKTLGTILIDDGAVRALTQG
RSLLPAGVTGVEGEFGRGDAVSVRDGAGVEIASGLSAYSSGDARAIMGHSSHEIEELLGY
SGRAEMIHRDDLVLKRAEIRERDPH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcaatcgacgggtgcatctctcgctaccgcgcaacgcgttgtcgttaaaatc
ggctcagcgctgctgaccgatcccgaaacgggcaagctgaaccgcacctggctgcaggca
ctggtggaagacgtggcgcggatgcaatcgcgcggacaggaaatgctgatcgtttcctcc
ggcgcgatcgcgctcggccggcgcgcattgaagctcccgcccggcaagctgaagctggag
gaaagccaggccgccgccgccgtgggccagatcggccttgcccatgcctttcaggaaata
ctttccgcctatggcttctcttgcgcgcagatccttgtgacgcttgaagatacggaagaa
cgccgccgctacctcaacgcgcgttcgacgatttccacactgctgaaattccgcgccgtt
ccggtcatcaatgagaacgacacggtcgcaacgagcgaaatccgctatggcgataatgac
cgcctcgcggcacgcgtcgccagcatggtttcggccgattgcctgatccttctgtcggat
gtcgacgggctctacaccgccccgccccatcttcccggcgcgcgccacctcgccgaagtg
gccgagatcacgccggagatcgaagcgatggcgggcgatgcggcgagcgaattttcacgg
ggcggcatgaagaccaagattgccgccgctcgcatcgcgaccgaatccggcgcacgcatg
gcgatcgcgaacggacgcggcctgcatcccctcaaagcattggaggaaggcgcgcgctgc
acctggttcgccgcgcattcgacgccggtggccgcccgaaagcgctggatatccgggtcg
ctgaagacgctcggcaccattttgatcgacgacggcgcggtgcgggctctcactcagggc
cgaagcttgcttcccgccggcgtaacaggcgtcgagggcgagttcggccgcggcgacgcc
gtcagcgtgcgcgacggcgcgggcgtcgaaatcgcgagcggtctcagcgcctattcgagc
ggggacgcgcgggccatcatgggccattcgagccacgaaatagaggaactgctcggctat
tcgggccgcgcggaaatgatccatcgcgacgatctggtacttaaaagggctgaaattcgc
gagcgcgatccccattaa

DBGET integrated database retrieval system