KEGG   Parvibaculum lavamentivorans: Plav_1853Help
Entry
Plav_1853         CDS       T00580                                 

Definition
acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pla00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2012412..2012966
Genome map
AA seq 184 aa AA seqDB search
MTHLTVYPDTDPATVLLDTRDGAEIAASLSGIGVVFERWDAPHALGEDADQTAVLAAYEA
DVKRLMDEGGYKSVDVVRVKPDNPNRAEMRQKFLAEHTHDDDEVRFFVEGAGAFYLRKDG
RVYRVVCERNDLISVPAGTTHWFDTGAAPHFCAIRIFTSPEGWVGHFTGDDIATRFPKFE
SEPQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacccatctcaccgtttatccggataccgatccggcgaccgtgttgctcgatacgaga
gacggggcggagattgccgcatcgctttccggcattggcgttgtgttcgagcgctgggat
gcaccgcatgcgcttggcgaagatgcggaccagacggccgtgcttgccgcctatgaagcc
gatgtgaagaggctcatggatgagggcgggtacaagagcgtcgatgtcgttcgcgtgaag
ccggacaatccgaaccgcgcggaaatgcgccagaaattcctcgccgaacatacgcatgac
gatgatgaagtgcggtttttcgtcgagggtgccggcgccttctatttgcggaaggatggc
cgtgtctaccgcgtcgtttgcgagcgcaacgatctcatttcggtgccggccggtacgacc
cattggttcgatacgggcgcggcaccgcatttctgtgcgatccgcattttcacatcgccg
gagggctgggtcggtcatttcacgggcgacgatatcgccacgcggtttcccaagttcgag
agcgagccgcaatga

DBGET integrated database retrieval system