KEGG   Parvibaculum lavamentivorans: Plav_1926Help
Entry
Plav_1926         CDS       T00580                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Plav_1926
   00052 Galactose metabolism
    Plav_1926
   00500 Starch and sucrose metabolism
    Plav_1926
   00520 Amino sugar and nucleotide sugar metabolism
    Plav_1926
Enzymes [BR:pla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Plav_1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2097937..2098824)
Genome map
AA seq 295 aa AA seqDB search
MTTSPRKIRKVVFPVAGLGTRFLPATKVIPKEMMTVVDKPVIQYAVEEAIEAGIEHFVFV
TGRGKGAIEDHFDLAYELEATLKARGKKAEFEMLQESRPAAGTASFVRQQEPLGLGHAVW
CARDIIGDEPFALALPDMLIHGARGCFAQMVDVYEAHGGNVIAVEEVPHEHVNRYGVVAL
AENLGNETHRVTGMVEKPKVEDAPSNLIISGRYILQPEVFSKLAVQKPGAGGEIQLTDAM
IALMGEQDFFSYRFEGTTYDCGDKIGYLAANVALALSRPDIAPKFRPVLDELTRK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttccccccgcaagatccgcaaggtcgtctttcccgttgccggcctcggcacc
cgctttctgccggcgaccaaagtcattccaaaggaaatgatgaccgtcgtcgacaagccg
gtcattcaatatgccgtggaagaggcgatcgaggcgggtatcgaacattttgtatttgtg
acaggacgcggcaagggcgccatcgaggatcacttcgatctcgcttacgaacttgaggcc
acgcttaaggcgcgcggcaagaaagcagaattcgaaatgctgcaagaaagccgccctgct
gccggaacagcaagcttcgttcgccagcaagagccgctcgggctcggccatgcagtatgg
tgcgcacgtgacatcattggtgatgagccgtttgctctcgccctccccgacatgctgatc
catggcgcccgtggctgctttgcccagatggtcgatgtttacgaagctcatggaggaaat
gtgatcgcggttgaagaagtgccccatgagcacgtcaaccgctacggcgtagtcgctctc
gcggaaaacctcggtaatgaaacgcatcgggttaccggcatggtcgaaaaaccgaaagtt
gaggacgcgccatccaacttgatcatttccggccgctacattctgcagccggaggttttt
tcaaagctggccgtgcagaagccgggcgcaggcggcgagattcagctgacggatgcgatg
attgcgttgatgggcgagcaggatttcttctcctaccgcttcgaaggcaccacctatgat
tgcggcgacaagatcggctatctcgccgccaatgtggcgcttgccctgtcgcggccggat
atagcgcccaagttccggccggtcctcgacgaattgacccgcaaataa

DBGET integrated database retrieval system