KEGG   Parvibaculum lavamentivorans: Plav_1937Help
Entry
Plav_1937         CDS       T00580                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Plav_1937
  Lipid metabolism
   00561 Glycerolipid metabolism
    Plav_1937
   00600 Sphingolipid metabolism
    Plav_1937
Enzymes [BR:pla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Plav_1937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2110780..2112093)
Genome map
AA seq 437 aa AA seqDB search
MTKVCMIGAGSTVFMKNLVGDILLNEMFADCHIALHDIDEARLKTSAIVAGKIADALSVS
PEITATTDRREALAGADFVIVMIQVAGYKPGTVVDFEIPKKHGLRQTIADTLGVGGIMRG
LRTVPVLLDIANDMRELCPRALMLQYVNPMAINCWALNRLAPDIAHVGLCHSVQGTAYEL
SKDLDVDYKSLRYQCAGINHMAFYTKFERELPDGTREDLYPKLKEIAARGEEPGWNKVRY
EMLRRTGYFVTESSEHFAEYVPWFIKRDRPDLIERFNIPLDEYIRRCEEQIAAWDAQERE
LVSANRLEVKFSGEYGAKIMRAVVSGKPTVINGNVANNGLIDNLPAGACVEVPCLVDANG
VTPTRVGALPPQLAAMMQTNINVQSLTMEAIATGKREHIYHAAMMDPHTAAELSLDQIWA
LVDDLIEAHGDWLPAYR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtctgcatgatcggcgcgggcagcactgttttcatgaaaaatctggtgggc
gacatcctgctgaacgagatgttcgcggattgccacatcgcgctgcacgacatcgatgag
gcacggctgaaaacttctgccatcgtggcgggaaagatcgccgatgcgctttcggtttca
cccgagatcaccgcgacgacggaccggcgcgaagctcttgcgggcgccgacttcgtgatc
gtcatgatccaggtcgcgggctacaagccgggcacggttgtcgattttgaaattccgaaa
aagcatggcctgcggcagaccatcgccgacacgctgggcgtgggcggaatcatgcgcgga
ctgcggaccgtgcccgtgctgctcgatatcgcaaacgatatgcgcgagctctgccccagg
gcgctcatgttgcaatatgtaaacccgatggcgatcaactgctgggcgctgaaccggctg
gcgcccgacatcgcccatgtcggcctctgccactcggtgcagggtacggcttacgaactc
tccaaggatctcgatgtcgactacaagtcgctgcgctatcaatgcgccggcatcaaccac
atggcgttctatacgaaattcgaacgcgaactgccggacggcacgcgcgaggatctctac
ccgaaactgaaagagattgcggcgcggggcgaggaaccgggctggaacaaggtacgctat
gaaatgctccgccggactggttatttcgtaaccgaatcgagcgaacacttcgccgaatat
gtgccgtggttcatcaagcgcgacaggccggacctgatcgagagattcaacattccgctc
gacgaatatatccgccgctgcgaggagcagatcgcggcatgggacgcgcaggagcgcgaa
ctcgtttcggcgaaccggctggaggtgaagttctccggcgaatatggtgcgaaaatcatg
cgcgcggtcgtgtcgggcaagcccaccgtcatcaacggcaatgtcgccaataacggcctc
atcgacaacctgccggcgggggcctgcgtggaggtgccttgcctcgtcgatgcgaacggc
gtgacgccgacgcgggtgggagccctgccgccgcagctcgcggcgatgatgcagaccaat
atcaacgtgcaatcgctgacgatggaagccatagccaccggcaagcgcgaacatatctac
catgccgccatgatggacccgcacacggcggcggagctttcgctcgaccagatatgggcg
ctcgtcgacgacctgatcgaggcacatggcgactggttgcccgcctaccgctag

DBGET integrated database retrieval system