KEGG   Parvibaculum lavamentivorans: Plav_1937Help
Entry
Plav_1937         CDS       T00580                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pla00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pla00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pla00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2110780..2112093)
Genome map
AA seq 437 aa AA seqDB search
MTKVCMIGAGSTVFMKNLVGDILLNEMFADCHIALHDIDEARLKTSAIVAGKIADALSVS
PEITATTDRREALAGADFVIVMIQVAGYKPGTVVDFEIPKKHGLRQTIADTLGVGGIMRG
LRTVPVLLDIANDMRELCPRALMLQYVNPMAINCWALNRLAPDIAHVGLCHSVQGTAYEL
SKDLDVDYKSLRYQCAGINHMAFYTKFERELPDGTREDLYPKLKEIAARGEEPGWNKVRY
EMLRRTGYFVTESSEHFAEYVPWFIKRDRPDLIERFNIPLDEYIRRCEEQIAAWDAQERE
LVSANRLEVKFSGEYGAKIMRAVVSGKPTVINGNVANNGLIDNLPAGACVEVPCLVDANG
VTPTRVGALPPQLAAMMQTNINVQSLTMEAIATGKREHIYHAAMMDPHTAAELSLDQIWA
LVDDLIEAHGDWLPAYR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtctgcatgatcggcgcgggcagcactgttttcatgaaaaatctggtgggc
gacatcctgctgaacgagatgttcgcggattgccacatcgcgctgcacgacatcgatgag
gcacggctgaaaacttctgccatcgtggcgggaaagatcgccgatgcgctttcggtttca
cccgagatcaccgcgacgacggaccggcgcgaagctcttgcgggcgccgacttcgtgatc
gtcatgatccaggtcgcgggctacaagccgggcacggttgtcgattttgaaattccgaaa
aagcatggcctgcggcagaccatcgccgacacgctgggcgtgggcggaatcatgcgcgga
ctgcggaccgtgcccgtgctgctcgatatcgcaaacgatatgcgcgagctctgccccagg
gcgctcatgttgcaatatgtaaacccgatggcgatcaactgctgggcgctgaaccggctg
gcgcccgacatcgcccatgtcggcctctgccactcggtgcagggtacggcttacgaactc
tccaaggatctcgatgtcgactacaagtcgctgcgctatcaatgcgccggcatcaaccac
atggcgttctatacgaaattcgaacgcgaactgccggacggcacgcgcgaggatctctac
ccgaaactgaaagagattgcggcgcggggcgaggaaccgggctggaacaaggtacgctat
gaaatgctccgccggactggttatttcgtaaccgaatcgagcgaacacttcgccgaatat
gtgccgtggttcatcaagcgcgacaggccggacctgatcgagagattcaacattccgctc
gacgaatatatccgccgctgcgaggagcagatcgcggcatgggacgcgcaggagcgcgaa
ctcgtttcggcgaaccggctggaggtgaagttctccggcgaatatggtgcgaaaatcatg
cgcgcggtcgtgtcgggcaagcccaccgtcatcaacggcaatgtcgccaataacggcctc
atcgacaacctgccggcgggggcctgcgtggaggtgccttgcctcgtcgatgcgaacggc
gtgacgccgacgcgggtgggagccctgccgccgcagctcgcggcgatgatgcagaccaat
atcaacgtgcaatcgctgacgatggaagccatagccaccggcaagcgcgaacatatctac
catgccgccatgatggacccgcacacggcggcggagctttcgctcgaccagatatgggcg
ctcgtcgacgacctgatcgaggcacatggcgactggttgcccgcctaccgctag

DBGET integrated database retrieval system