KEGG   Parvibaculum lavamentivorans: Plav_1938Help
Entry
Plav_1938         CDS       T00580                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Plav_1938
Enzymes [BR:pla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Plav_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2112189..2114183
Genome map
AA seq 664 aa AA seqDB search
MPQAQSLTDVSIGVCYYPEHWPEAMWPEDARRMREAGISRVRIGEFAWSRLEPEPGTYDF
DWLSRALDTLHGEGLQVVLGTPTATPPKWLVDSMPDMLPVDRHGRPRGFASRRHYCFSHA
GYRRECARIVKALAETFGQHPAIVAWQTDNEYGCHDTVLSYSDEARLGFRHWLRDRYGSV
AALNDAWGNVFWSMEYRSFDEIDLPSGTVTEANPAHRADFHRYSSDQVAAFNRVQVEIIR
ALSPGRDILHNFMTFFLDFDHYEVMKDLDIATWDSYPLGSLDVFPGDAAHKTAFMRTGDP
DLQAFHHDLYRGAGRGRFWVMEQQPGPVNWAHYNVDAQPGLVRLWGLEGFAHGAETISYF
RWRQAPFAQEQFHAGLNLPDGEPDRAFHEVKQLSQDLASLGPLGASASARVALVFSYEAA
WFLRVQPQGRSFSYVEQVFAMYRSLRRLGLDVDVVGPDAEVSGYALVLVPSMPHVPERLA
ASLAACKGTLLIAARSGSRTASHRIPDNLAPGILSGLLGVKVTRAESFRPHGAVPVRYDN
ENYSFDRWREFVVPEAGVEVLAETEDGHPAFTRKGRAHYLAGWPDDAFLNGVVERLAREA
GLATGELPAGLRSRRRGPYRFVFNYGPAAADISPYFPASEFVLGQPRLEVGGVAVLHTDV
PANG
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagctcaaagcctcaccgacgtctcgatcggcgtctgctattacccggagcac
tggccggaagccatgtggccggaggatgcccggcgcatgcgtgaggcggggatttcccgc
gtccgcatcggcgagttcgcctggtcccggctggagccggagccgggaacttacgatttc
gactggctatcccgcgcgctcgatacgctgcatggcgagggcctccaggtcgttctcggg
acgccgacggcaacgccccccaaatggctggtcgattcgatgcccgacatgttgccggta
gaccggcatgggcggccccgcggctttgcgtcgcgccgccactactgcttctcccatgcc
ggataccggcgcgaatgtgcgcgtatcgtgaaggcgctggctgagacattcgggcagcat
ccggccatcgtcgcctggcagaccgacaatgaatatggctgccacgacacggtgctttcc
tattccgacgaggcgcggctcggctttcgtcattggctgcgcgatcgctacggatcggtc
gccgcgctcaacgatgcctggggcaatgtcttctggagcatggaatatcgcagcttcgat
gagatcgacctgccttccggcacggtcacggaggcgaacccggcacatcgcgccgatttt
catcgctattcgtcggatcaggtcgcggcgttcaatcgcgtgcaggtcgaaatcatccgc
gccctttcgcccggccgcgacattctccacaatttcatgaccttctttctcgacttcgat
cactacgaggtgatgaaggacctcgatattgcaacctgggattcctatccgctgggaagt
ctcgacgtctttccgggcgacgccgctcacaagaccgcctttatgcgcacgggcgatccc
gatcttcaggcattccaccacgatctttatcggggtgccggccgtggccgcttctgggtc
atggagcagcagcccggcccggtgaactgggcgcattacaacgtggatgcgcagcccggt
ctcgtccgtctctgggggcttgagggcttcgcgcatggtgcggagacgatttcttacttc
cgctggcggcaggcgcctttcgcgcaggagcagtttcatgccgggctcaacctgccggat
ggcgaaccggaccgcgccttccatgaagtgaagcagctctcgcaggatctcgcctcgctc
ggtccgctcggtgcgtccgcttccgcacgggtggcgctcgtcttttcctatgaggcggca
tggttcctccgcgtgcagccgcaagggcgcagcttctcctatgtggagcaggtctttgcg
atgtaccgctcgctccgccgtctcgggctcgatgtcgatgtcgtcgggcccgatgccgaa
gtgagcggttacgcgcttgtcctcgttccttccatgccgcatgtgccggagcgtctcgcc
gcgtcgctcgcggcttgcaagggaacgctcctcattgccgcacgcagcggcagccgcaca
gcgtctcaccggataccggacaatctcgctcccggcatcctctccggcctgctcggcgta
aaggtcacgcgcgccgagagtttccggccccacggcgccgttcccgtccgctacgacaat
gaaaactacagcttcgaccgctggcgcgaattcgtcgttccggaggcgggcgtcgaggtg
ctggcggagacggaagacgggcatccggccttcacccgcaagggccgcgcgcattacctc
gccggctggccggacgacgcattcctcaacggggtagtggagcggctggcgcgggaggcg
ggcctcgcaacgggcgagcttccagccggcttgcgcagccgccggcgtgggccttaccgc
ttcgttttcaactacggcccggccgccgccgacatctcgccttatttccccgctagtgag
tttgtgctcggccaaccccggcttgaagtcggcggtgtggcggttctgcatacggacgtt
ccagcgaacggttaa

DBGET integrated database retrieval system