KEGG   Parvibaculum lavamentivorans: Plav_1938Help
Entry
Plav_1938         CDS       T00580                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pla00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2112189..2114183
Genome map
AA seq 664 aa AA seqDB search
MPQAQSLTDVSIGVCYYPEHWPEAMWPEDARRMREAGISRVRIGEFAWSRLEPEPGTYDF
DWLSRALDTLHGEGLQVVLGTPTATPPKWLVDSMPDMLPVDRHGRPRGFASRRHYCFSHA
GYRRECARIVKALAETFGQHPAIVAWQTDNEYGCHDTVLSYSDEARLGFRHWLRDRYGSV
AALNDAWGNVFWSMEYRSFDEIDLPSGTVTEANPAHRADFHRYSSDQVAAFNRVQVEIIR
ALSPGRDILHNFMTFFLDFDHYEVMKDLDIATWDSYPLGSLDVFPGDAAHKTAFMRTGDP
DLQAFHHDLYRGAGRGRFWVMEQQPGPVNWAHYNVDAQPGLVRLWGLEGFAHGAETISYF
RWRQAPFAQEQFHAGLNLPDGEPDRAFHEVKQLSQDLASLGPLGASASARVALVFSYEAA
WFLRVQPQGRSFSYVEQVFAMYRSLRRLGLDVDVVGPDAEVSGYALVLVPSMPHVPERLA
ASLAACKGTLLIAARSGSRTASHRIPDNLAPGILSGLLGVKVTRAESFRPHGAVPVRYDN
ENYSFDRWREFVVPEAGVEVLAETEDGHPAFTRKGRAHYLAGWPDDAFLNGVVERLAREA
GLATGELPAGLRSRRRGPYRFVFNYGPAAADISPYFPASEFVLGQPRLEVGGVAVLHTDV
PANG
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagctcaaagcctcaccgacgtctcgatcggcgtctgctattacccggagcac
tggccggaagccatgtggccggaggatgcccggcgcatgcgtgaggcggggatttcccgc
gtccgcatcggcgagttcgcctggtcccggctggagccggagccgggaacttacgatttc
gactggctatcccgcgcgctcgatacgctgcatggcgagggcctccaggtcgttctcggg
acgccgacggcaacgccccccaaatggctggtcgattcgatgcccgacatgttgccggta
gaccggcatgggcggccccgcggctttgcgtcgcgccgccactactgcttctcccatgcc
ggataccggcgcgaatgtgcgcgtatcgtgaaggcgctggctgagacattcgggcagcat
ccggccatcgtcgcctggcagaccgacaatgaatatggctgccacgacacggtgctttcc
tattccgacgaggcgcggctcggctttcgtcattggctgcgcgatcgctacggatcggtc
gccgcgctcaacgatgcctggggcaatgtcttctggagcatggaatatcgcagcttcgat
gagatcgacctgccttccggcacggtcacggaggcgaacccggcacatcgcgccgatttt
catcgctattcgtcggatcaggtcgcggcgttcaatcgcgtgcaggtcgaaatcatccgc
gccctttcgcccggccgcgacattctccacaatttcatgaccttctttctcgacttcgat
cactacgaggtgatgaaggacctcgatattgcaacctgggattcctatccgctgggaagt
ctcgacgtctttccgggcgacgccgctcacaagaccgcctttatgcgcacgggcgatccc
gatcttcaggcattccaccacgatctttatcggggtgccggccgtggccgcttctgggtc
atggagcagcagcccggcccggtgaactgggcgcattacaacgtggatgcgcagcccggt
ctcgtccgtctctgggggcttgagggcttcgcgcatggtgcggagacgatttcttacttc
cgctggcggcaggcgcctttcgcgcaggagcagtttcatgccgggctcaacctgccggat
ggcgaaccggaccgcgccttccatgaagtgaagcagctctcgcaggatctcgcctcgctc
ggtccgctcggtgcgtccgcttccgcacgggtggcgctcgtcttttcctatgaggcggca
tggttcctccgcgtgcagccgcaagggcgcagcttctcctatgtggagcaggtctttgcg
atgtaccgctcgctccgccgtctcgggctcgatgtcgatgtcgtcgggcccgatgccgaa
gtgagcggttacgcgcttgtcctcgttccttccatgccgcatgtgccggagcgtctcgcc
gcgtcgctcgcggcttgcaagggaacgctcctcattgccgcacgcagcggcagccgcaca
gcgtctcaccggataccggacaatctcgctcccggcatcctctccggcctgctcggcgta
aaggtcacgcgcgccgagagtttccggccccacggcgccgttcccgtccgctacgacaat
gaaaactacagcttcgaccgctggcgcgaattcgtcgttccggaggcgggcgtcgaggtg
ctggcggagacggaagacgggcatccggccttcacccgcaagggccgcgcgcattacctc
gccggctggccggacgacgcattcctcaacggggtagtggagcggctggcgcgggaggcg
ggcctcgcaacgggcgagcttccagccggcttgcgcagccgccggcgtgggccttaccgc
ttcgttttcaactacggcccggccgccgccgacatctcgccttatttccccgctagtgag
tttgtgctcggccaaccccggcttgaagtcggcggtgtggcggttctgcatacggacgtt
ccagcgaacggttaa

DBGET integrated database retrieval system