KEGG   Parvibaculum lavamentivorans: Plav_1981Help
Entry
Plav_1981         CDS       T00580                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Plav_1981
Enzymes [BR:pla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Plav_1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2164599..2165510
Genome map
AA seq 303 aa AA seqDB search
MPEGGEARWLLTNEGVRLRVFTWPGAREGRGTVFLFGGRTEFVEKYFEVVGELRARGFAV
VSFDWRGQGLSDRPLADSRKGHIDDFATFDSDLALLMSEVAPAFPKPWTAFAHSMGGQIL
IRAAHDHPEWFSRIVLSAPMLGLRFSRAAERAIRALAFAFHAAGLAGRYVPGGTPKAADE
TPFEENILTSDEKRYALLQSLVQAEPKLGLGGATVGWLRAAFRSMDMAAAPGWLGSIKTP
VLICEAARDALISPLALRHAAAHLPACELVTIPDAKHEILIERDPARAAFWQAFDRFMGI
GNQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaggcggcgaggcgcgctggcttctcacgaatgagggcgtgcggctccgcgtc
ttcacatggccgggcgcgcgggaagggcgcggcaccgtctttcttttcggcgggcgcacg
gaattcgtcgaaaaatatttcgaggtggtgggcgagttgcgggcgcgcggtttcgccgtc
gtcagtttcgactggcgggggcaggggctttcggatcgtccgcttgcagacagccgcaag
ggccatatagacgactttgccaccttcgacagcgaccttgcgcttttgatgtcggaagtg
gcgcccgcctttccaaagccctggacggctttcgcgcattcaatgggcggccaaatcctc
atccgcgccgcgcatgatcaccccgaatggttttctcgcatcgtcctttccgcgcccatg
cttggactccgcttcagccgcgcggccgaacgcgccattcgcgcgctcgccttcgctttc
catgccgcgggtctcgccgggcgctatgtgccgggcggcacgccgaaagcagcggacgag
acgcccttcgaggaaaatattctgacgagcgacgaaaaacgctatgcgctgctgcaatct
ctcgtccaggccgagccgaaactcggcctcggcggcgccacggtcggctggcttcgcgcc
gccttccggtcgatggacatggccgccgcgcccggctggctcggttcgataaaaacaccg
gtcctcatctgcgaagccgcgcgcgacgcgctcatctcgccgctcgcattgcgccacgcg
gcggcgcatctccccgcctgcgagctggtcacgatcccggatgcaaaacacgaaatcctg
atcgaacgcgatcccgcccgcgccgccttctggcaggccttcgacaggttcatgggcata
ggcaatcaatag

DBGET integrated database retrieval system