KEGG   Parvibaculum lavamentivorans: Plav_2249Help
Entry
Plav_2249         CDS       T00580                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00480  Glutathione metabolism
pla00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Plav_2249
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Plav_2249
Enzymes [BR:pla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Plav_2249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABS63863
JGI: Plav2249
UniProt: A7HVD0
Position
complement(2422833..2423321)
Genome map
AA seq 162 aa AA seqDB search
MTGKTAYDFDFLSLKGKPLPLADFAGHPLLIVNTASKCGFTRQYKELEALWQKYRDDGLV
VLGVPSNDFANQEPGGAAEIASFCETNFGVDFPLTEKVAVKGRAAHPLFQWLAREGGFLS
RPRWNFYKYVIGKDGKLVDWFASTTTPGSAKVERAIEKAVRG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggaaaaccgcttacgatttcgatttcctgagcctgaagggaaagcccctgccg
ctcgccgacttcgcgggccacccgctgctgatcgtcaacaccgcttcgaaatgcggcttc
acgcggcaatacaaggagctggaggcgctctggcagaaatatcgcgacgacgggctcgtc
gttctcggcgtgccctccaacgatttcgcgaaccaggagccgggcggcgccgccgagatc
gcgagtttctgcgaaaccaatttcggcgtcgactttccgctcaccgaaaaggtggccgtg
aaaggccgggccgcgcatccgctgttccagtggctggcgcgcgagggcggctttctctcg
cggccgcgctggaacttctacaaatatgtgatcggcaaggacggcaagctcgtcgactgg
ttcgccagcaccacgacgccgggctcggcgaaggtcgagcgcgcgatcgagaaggcggtg
cgggggtag

DBGET integrated database retrieval system