KEGG   Parvibaculum lavamentivorans: Plav_2511Help
Entry
Plav_2511         CDS       T00580                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
pla  Parvibaculum lavamentivorans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pla00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pla02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2712226..2712624)
Genome map
AA seq 132 aa AA seqDB search
MRDLFHGFAAISLAMTISGAALAEGPDLADGKKIFARCKACHTLEEGGKDGIGPNLHGVF
GRTAGTKEGVKFSKAMTAKGAEGLVWSEETLSVYLEKPAAMVPGTNMAFPGLKKEEDRAS
LIAYLKSETGAE
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacctgttccacggatttgcagcgatttcccttgccatgaccatttcgggcgcc
gcgctggccgaagggccggacctcgcggacggcaagaagatcttcgcccgctgcaaggct
tgccataccctcgaggaaggcggcaaggacggcatcggcccgaaccttcacggcgtattc
ggccgcaccgccggcaccaaggaaggcgtgaaattctccaaggcgatgacggcaaaaggc
gccgagggcctggtctggtcggaagagaccctgtcggtctatctcgaaaagccggctgcc
atggttcccggcacgaacatggctttcccgggcctcaagaaggaagaggaccgcgccagc
ctgatcgcctatctcaaatccgaaaccggcgcggaataa

DBGET integrated database retrieval system