KEGG   Parvibaculum lavamentivorans: Plav_2664Help
Entry
Plav_2664         CDS       T00580                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Plav_2664
Enzymes [BR:pla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Plav_2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2865179..2865847)
Genome map
AA seq 222 aa AA seqDB search
MAGKPLDEIGRMDMNAAVDGLRAQPDDERLTQVEKPSREAAEAAVRTLIAWAGDNPQREG
LIDTPGRVVRAYEEFFEGYNEDPYKELTRTFEEVEGYNDMVMLRDINIESHCEHHMVAIL
GKAHVAYVPTKKVVGISKLARVIEIYSKRLQTQETMTAQIAETINAALQPQGVAILIEAK
HQCMTTRGIKKPDVATITTQFTGVFRDDPRMESRFMQMIRGY
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaaacccctagacgagattggtcgaatggacatgaatgctgcagttgatggg
ctccgcgcccagccggatgacgagcgcctgacgcaagtcgagaagccgagccgcgaggcg
gcggaagccgccgtgcgcaccctcatcgcctgggcgggcgacaatccgcaacgtgaaggc
ctgatcgacacccccggccgcgtcgtgcgcgcctatgaggagttcttcgagggctacaac
gaagacccctacaaggaactgacccgcaccttcgaggaagtcgaaggctataacgacatg
gtcatgctccgcgacatcaacatcgagtcgcattgcgagcatcacatggtggccattctc
ggcaaggcacatgtcgcctatgtcccgaccaagaaggtcgtcggcatatcgaagctcgcc
cgcgtcatcgagatctattccaagcgcctccagacgcaggagacgatgacggcccagatc
gcggaaaccatcaatgccgcgctccagccgcaaggcgtcgccatcctcatcgaggcgaag
catcaatgcatgacgacgcgcggcatcaagaagccggatgtcgccaccatcaccacgcag
ttcaccggcgtcttccgcgacgatccccgcatggaaagccggttcatgcagatgatccgc
ggatactga

DBGET integrated database retrieval system