KEGG   Parvibaculum lavamentivorans: Plav_2664Help
Entry
Plav_2664         CDS       T00580                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00790  Folate biosynthesis
pla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Plav_2664
Enzymes [BR:pla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Plav_2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: ABS64272
JGI: Plav2664
UniProt: A7HWI9
Position
complement(2865179..2865847)
Genome map
AA seq 222 aa AA seqDB search
MAGKPLDEIGRMDMNAAVDGLRAQPDDERLTQVEKPSREAAEAAVRTLIAWAGDNPQREG
LIDTPGRVVRAYEEFFEGYNEDPYKELTRTFEEVEGYNDMVMLRDINIESHCEHHMVAIL
GKAHVAYVPTKKVVGISKLARVIEIYSKRLQTQETMTAQIAETINAALQPQGVAILIEAK
HQCMTTRGIKKPDVATITTQFTGVFRDDPRMESRFMQMIRGY
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaaacccctagacgagattggtcgaatggacatgaatgctgcagttgatggg
ctccgcgcccagccggatgacgagcgcctgacgcaagtcgagaagccgagccgcgaggcg
gcggaagccgccgtgcgcaccctcatcgcctgggcgggcgacaatccgcaacgtgaaggc
ctgatcgacacccccggccgcgtcgtgcgcgcctatgaggagttcttcgagggctacaac
gaagacccctacaaggaactgacccgcaccttcgaggaagtcgaaggctataacgacatg
gtcatgctccgcgacatcaacatcgagtcgcattgcgagcatcacatggtggccattctc
ggcaaggcacatgtcgcctatgtcccgaccaagaaggtcgtcggcatatcgaagctcgcc
cgcgtcatcgagatctattccaagcgcctccagacgcaggagacgatgacggcccagatc
gcggaaaccatcaatgccgcgctccagccgcaaggcgtcgccatcctcatcgaggcgaag
catcaatgcatgacgacgcgcggcatcaagaagccggatgtcgccaccatcaccacgcag
ttcaccggcgtcttccgcgacgatccccgcatggaaagccggttcatgcagatgatccgc
ggatactga

DBGET integrated database retrieval system