KEGG   Parvibaculum lavamentivorans: Plav_2704Help
Entry
Plav_2704         CDS       T00580                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Plav_2704
Enzymes [BR:pla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Plav_2704
Exosome [BR:pla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Plav_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2908241..2909734
Genome map
AA seq 497 aa AA seqDB search
MAADYILSIDQGTTSTRALLFDRSGSPMRVRQKDLRQIFPQDGWVEHDAAEIWAATLEVC
RGLLTAGTTAGNVAAIGITNQRETTVLWERATGKPLHNAIVWQDRRTAQLCAKLKAEGKE
PVVQAKTGLLLDPYFSGTKLAWLLDRVEGARERAKKGELCFGTIDSWLIFNLTGRKVHAT
DATNASRTLLFNIETQDWDDELLGWFDIPREILPEVKDCCADFGVTEKELFGIEIPVAGV
AGDQQAATVGQACFEPGLIKSTYGTGCFAVVNTGERRVESRNRLLGTVAYRIGGKTTYAL
EGSIFMAGAIVQWLRDEMGLVAKSEDSEAMARDANPNSHAVLVPAFTGLGAPYWEPDARA
ALFGMTRDTGAKEIVRAALESVSYQTRDLMDAMAADMKAAGLKSPQALRVDGGMVANNWF
AQNLADILARPVERPEITETTALGAAYLAGMHVGFYGDMSDVAAHWRCERAFSPKMAEAE
RAERYERWRGCVKRVIG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgactacattctttccatcgatcaggggacgacgagcacgcgggcgctgctg
ttcgaccggtcgggttcgccgatgcgggtgcggcagaaggatttgcggcagatatttccg
caggatggctgggtggagcatgacgcggccgagatctgggcggcgacgctggaggtttgc
cgggggctgctgacggcgggaacgacggcggggaatgtcgcggccatcggcatcaccaat
caacgcgagacgacggtgctttgggagcgggcgacggggaagcccttgcacaatgccatc
gtgtggcaggaccggcggacggcgcagctttgcgcgaagctgaaggcggagggcaaggag
cccgtcgtacaggcgaagacggggctgctgctcgatccttatttttcggggacgaagctc
gcatggctgctcgaccgtgtggagggcgcgcgggagagggcgaagaagggcgagctctgc
ttcgggaccatcgactcgtggctcatcttcaatctcacgggcaggaaagtgcatgcgacc
gacgcgacgaatgcgtcgcggacgttgctcttcaacatcgagacacaggactgggacgac
gagctgctcggctggttcgacattccgcgcgagatactgccggaggtaaaggattgctgc
gcggatttcggcgtgaccgagaaagagttgttcggcatcgagatcccggtggcgggcgtg
gcaggggaccagcaggcggcgacggtggggcaggcatgtttcgagccggggctcatcaaa
tcgacctatgggacgggttgcttcgcggtggtgaatacgggcgagcggcgcgtcgaaagc
cggaacaggctgcttgggaccgtcgcctaccggatcggcggcaagacgacctatgcgctg
gagggttcgatcttcatggcgggggcgatcgtgcaatggctgcgcgacgagatggggctg
gtggcgaagtccgaagacagtgaggcgatggcgcgcgatgcgaacccgaacagccatgcc
gtgctggtgccggcgttcacggggctcggcgcgccttactgggagccggatgcccgggcg
gcgctgttcggcatgacgcgggatacgggcgcgaaggagatcgtacgggcggcgctcgaa
agcgtgtcctaccagacgcgggacctgatggatgcgatggcggcggacatgaaggcggcg
gggctcaaaagcccgcaggcgctgcgcgtcgatggcgggatggtggcgaacaactggttc
gcgcagaacctcgccgacattctggcgcggccggtggaacggccggaaatcaccgagacg
acggccttgggcgcggcctatctggcggggatgcatgtggggttttacggcgacatgagc
gacgtcgccgcgcattggcgctgcgagcgggcgttttcgccgaagatggcggaagctgag
cgggcggagcggtatgagcggtggcgggggtgcgtgaagcgggtgatcggatga

DBGET integrated database retrieval system