KEGG   Parvibaculum lavamentivorans: Plav_2704Help
Entry
Plav_2704         CDS       T00580                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pla00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2908241..2909734
Genome map
AA seq 497 aa AA seqDB search
MAADYILSIDQGTTSTRALLFDRSGSPMRVRQKDLRQIFPQDGWVEHDAAEIWAATLEVC
RGLLTAGTTAGNVAAIGITNQRETTVLWERATGKPLHNAIVWQDRRTAQLCAKLKAEGKE
PVVQAKTGLLLDPYFSGTKLAWLLDRVEGARERAKKGELCFGTIDSWLIFNLTGRKVHAT
DATNASRTLLFNIETQDWDDELLGWFDIPREILPEVKDCCADFGVTEKELFGIEIPVAGV
AGDQQAATVGQACFEPGLIKSTYGTGCFAVVNTGERRVESRNRLLGTVAYRIGGKTTYAL
EGSIFMAGAIVQWLRDEMGLVAKSEDSEAMARDANPNSHAVLVPAFTGLGAPYWEPDARA
ALFGMTRDTGAKEIVRAALESVSYQTRDLMDAMAADMKAAGLKSPQALRVDGGMVANNWF
AQNLADILARPVERPEITETTALGAAYLAGMHVGFYGDMSDVAAHWRCERAFSPKMAEAE
RAERYERWRGCVKRVIG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgactacattctttccatcgatcaggggacgacgagcacgcgggcgctgctg
ttcgaccggtcgggttcgccgatgcgggtgcggcagaaggatttgcggcagatatttccg
caggatggctgggtggagcatgacgcggccgagatctgggcggcgacgctggaggtttgc
cgggggctgctgacggcgggaacgacggcggggaatgtcgcggccatcggcatcaccaat
caacgcgagacgacggtgctttgggagcgggcgacggggaagcccttgcacaatgccatc
gtgtggcaggaccggcggacggcgcagctttgcgcgaagctgaaggcggagggcaaggag
cccgtcgtacaggcgaagacggggctgctgctcgatccttatttttcggggacgaagctc
gcatggctgctcgaccgtgtggagggcgcgcgggagagggcgaagaagggcgagctctgc
ttcgggaccatcgactcgtggctcatcttcaatctcacgggcaggaaagtgcatgcgacc
gacgcgacgaatgcgtcgcggacgttgctcttcaacatcgagacacaggactgggacgac
gagctgctcggctggttcgacattccgcgcgagatactgccggaggtaaaggattgctgc
gcggatttcggcgtgaccgagaaagagttgttcggcatcgagatcccggtggcgggcgtg
gcaggggaccagcaggcggcgacggtggggcaggcatgtttcgagccggggctcatcaaa
tcgacctatgggacgggttgcttcgcggtggtgaatacgggcgagcggcgcgtcgaaagc
cggaacaggctgcttgggaccgtcgcctaccggatcggcggcaagacgacctatgcgctg
gagggttcgatcttcatggcgggggcgatcgtgcaatggctgcgcgacgagatggggctg
gtggcgaagtccgaagacagtgaggcgatggcgcgcgatgcgaacccgaacagccatgcc
gtgctggtgccggcgttcacggggctcggcgcgccttactgggagccggatgcccgggcg
gcgctgttcggcatgacgcgggatacgggcgcgaaggagatcgtacgggcggcgctcgaa
agcgtgtcctaccagacgcgggacctgatggatgcgatggcggcggacatgaaggcggcg
gggctcaaaagcccgcaggcgctgcgcgtcgatggcgggatggtggcgaacaactggttc
gcgcagaacctcgccgacattctggcgcggccggtggaacggccggaaatcaccgagacg
acggccttgggcgcggcctatctggcggggatgcatgtggggttttacggcgacatgagc
gacgtcgccgcgcattggcgctgcgagcgggcgttttcgccgaagatggcggaagctgag
cgggcggagcggtatgagcggtggcgggggtgcgtgaagcgggtgatcggatga

DBGET integrated database retrieval system