KEGG   Parvibaculum lavamentivorans: Plav_2866Help
Entry
Plav_2866         CDS       T00580                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pla00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3070814..3071377
Genome map
AA seq 187 aa AA seqDB search
MMSDIRPHIPGILVALGGNLATVHGSPVKTLEAALAVMPGFGIRVVKCAHLYKTPALSSY
VQPDYVNSVVSIETALPPADLLNILHRIEAIFGRVRRERWASRPLDLDLLDYRGMIMPAA
GPRGADAGAGKLPLALPHPGIALRGFVLLPLRDVAPEWRHPVTGESVDRLIAALGPGGLA
GIERTGS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgatatcaggccacatattcccggcattcttgtggcactgggcggcaacctg
gccaccgtgcatggcagccccgtgaagacgctggaggctgcgctggcagtgatgcccggg
ttcggcattcgcgtcgtgaaatgtgcgcatctatacaagacgccggcgctttcctcttat
gtacagcctgattacgttaattctgtcgtctccatcgagacggccctgccgcccgcggat
cttctcaatatcctgcaccggatcgaagctatcttcggccgggtgcggcgggagcgatgg
gcgtcccggcccctcgatctcgatctgctggactaccggggaatgattatgccggctgcg
ggaccccgtggcgccgatgcgggagcgggaaaattgccgcttgcgctgccgcatccggga
atcgcgctgcgaggcttcgtgcttctgccgctccgcgatgtggcgcctgaatggcggcac
ccggtaacgggagaaagtgtcgaccgcttgattgccgcattggggcccggtggtctggcc
ggaattgagcggacgggtagttga

DBGET integrated database retrieval system