KEGG   Parvibaculum lavamentivorans: Plav_3044Help
Entry
Plav_3044         CDS       T00580                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00790  Folate biosynthesis
pla01100  Metabolic pathways
pla02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Plav_3044
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Plav_3044
Enzymes [BR:pla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Plav_3044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: ABS64651
JGI: Plav3044
UniProt: A7HXL8
Position
complement(3245650..3247782)
Genome map
AA seq 710 aa AA seqDB search
MSGASLDRREFLKLFAATAGCFVATAMTTPFVPSLGTARAARGAFHFPQGLASGDPQPDA
VMLWTRVEAIDPEAALPNGDIDLYVQVATDTDFARVVVQQAVRATRASDHTVRVFVRGLA
PDTVYYYRFYAGGDSSAEPGRTRTAPRPGTKRDVRFAAVSCQNYEQGYYGALRRLVNDDI
AAAPEQQIDFVLHLGDFIYERTGDVPEDRRPSRLAGPLPDGTEPWVPDGTRPWWQKGGQA
AVSLADYRALYKTYLTDPDLQAARARFPFVHTWDDHEFTNDAWQSHDTYFGDGGPAAKRK
LAANKAWFEFIPAVLSQTPKFNGIERAAHDFRNVRVEDGELGEPDENYLYQGTDNLKAIS
SLTIYRTLRWGAMLDMVITDLRSYRSPPVITEEIKGFIKGAPVPPVRLVKLLDAGRSAND
GNPPETLRYGGKEMPNPRVKAPRGTQLGGPQKAWFKAAMKASTARWRIWANSAPALQMRL
DFARIPFAGLEDGYVGTDAWQGYPGELAELMSFLKEEKIGNVVSLAGDYHAFAAGRLPVD
PDADELTFAALEIMTGAISSGSMYEGAARATRDSGFFHRAVVLDDEGTKRENWNNTLVNG
LRAGILANYSSSEYIHNMFRNERASPGLDYMDADGHGYTLVTLTDTTMQVEQVNVGDVTR
DAGPEGAAVLRRARFSAKPWDGGGEPALEGPVFEGTPPYPWIANEKDKET
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggcgtcgctagaccgtcgcgaatttctgaagctgtttgcggcaacggcggga
tgcttcgtcgccaccgcgatgaccacgccctttgtgccgtcacttggcacggcaagagcg
gcgcgcggcgcctttcattttccgcaaggcctggcctccggtgacccgcagccggacgcc
gtcatgctgtggacgcgcgtcgaggcaatcgacccggaggcggcgttgccgaacggcgat
atcgacctttacgtgcaggtcgcgaccgatacggatttcgcgcgcgtggtcgtacaacaa
gcggtacgggcgacacgcgcctccgaccacaccgtccgcgtcttcgtgcgcgggctcgct
cccgacactgtttactattatcgcttctatgccggcggcgacagctcggccgagccgggc
cgcacgcgcaccgcgccacgccccggcaccaagcgcgacgtacgctttgccgctgtctcc
tgccagaactacgagcaaggctattacggcgcgttgcggcggctggtgaatgacgacatt
gccgccgcgccggagcaacagatcgacttcgtgctgcatcttggcgacttcatttacgaa
cgcactggcgatgtgccggaagaccggcggccgtcgcggctggccggccccctgcccgac
ggcacggaaccctgggtgccggacggcacaagaccgtggtggcagaagggcggacaggcc
gccgtttcgcttgccgattaccgcgcgctctacaagacctatctcaccgatcccgacctg
caggcggcacgggcacgctttcctttcgtgcatacatgggacgaccatgaattcacgaac
gatgcctggcagagccacgacacttatttcggcgatggcgggcccgcggcaaagcggaag
ctcgccgccaacaaggcgtggtttgaattcattcccgcagtgctctctcaaacgccgaaa
ttcaacggcatcgaacgcgcggcgcatgacttccggaatgtgcgtgtcgaggatggcgag
ctgggcgaaccggacgagaactatctctatcagggtacggacaacctgaaagccatatcg
agcctcaccatttaccggacgctgcgctggggcgcgatgctcgacatggtgataacagac
cttcggagctatcggagcccacctgtcattaccgaagagataaagggtttcatcaagggc
gcacccgtgccacccgtccgcctggtcaaactgctggatgccggacgcagcgcgaatgac
ggcaacccgcccgagacactccgctatggcggcaaggaaatgccgaacccgcgcgtcaag
gcgccgcgcggcacgcagctgggcggaccgcaaaaggcatggttcaaggccgcgatgaaa
gcctcgacggcgagatggcggatctgggccaatagcgcccccgcattgcagatgcggctc
gatttcgcgcgcatccccttcgcggggcttgaggacggctatgtcgggaccgatgcctgg
cagggctatcccggcgaactcgcggagctgatgtcttttctgaaggaagaaaagatcggc
aatgtcgtttccctggcgggcgactatcacgccttcgcggcgggccgcttgcctgtcgat
cccgatgcggatgaactcaccttcgcggcgctcgaaatcatgacgggcgcgatcagctcc
ggctcgatgtatgaaggcgccgcccgcgcgacgcgcgacagcggctttttccatcgtgcc
gtggtgctcgatgacgaggggacaaagcgcgagaactggaacaacacgctggtgaacggc
ctgcgcgccggcattctcgcgaattattcgtcctccgaatatatccacaacatgttccgc
aacgagcgcgcgagccccggcctcgactacatggatgccgatggccacggctatacgctt
gtaacgctgaccgacaccacaatgcaggtggagcaagtgaatgtcggcgacgtgacgagg
gatgctggccccgaaggagcggccgttctgcgccgcgcccgcttttcggccaagccatgg
gacggtggaggcgaaccggcacttgaaggcccggtcttcgagggcacccctccctatccc
tggattgcgaacgagaaagacaaagagacctga

DBGET integrated database retrieval system