KEGG   Parvibaculum lavamentivorans: Plav_3070Help
Entry
Plav_3070         CDS       T00580                                 

Definition
(GenBank) thiolase family protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Plav_3070
   00630 Glyoxylate and dicarboxylate metabolism
    Plav_3070
   00640 Propanoate metabolism
    Plav_3070
   00650 Butanoate metabolism
    Plav_3070
  Lipid metabolism
   00071 Fatty acid degradation
    Plav_3070
   00072 Synthesis and degradation of ketone bodies
    Plav_3070
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Plav_3070
   00310 Lysine degradation
    Plav_3070
   00380 Tryptophan metabolism
    Plav_3070
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Plav_3070
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Plav_3070
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Plav_3070
Enzymes [BR:pla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Plav_3070
Exosome [BR:pla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Plav_3070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3277908..3279110
Genome map
AA seq 400 aa AA seqDB search
MAAGIKDKVAILGMGCSKFGERWDAGPEELMVEAYLEAMQDAGIEPTQLDAAWFSTHIDE
IGTGKGGTPLSVALRLPNIAVTRVENFCASGSEAFRGAVYAVASGAADIALAVGVEKLKD
TGYGGLPVGNMGTLNPQWSPSGSAPGNFAQLASAYRAKHGVSKEDLKRAIAHVSVKSHAN
GAKNPKAHLRNEVTEDQVMNAPMIAEPLGLFDCCGVSDGAAAVIVTTPEIAKAMGKKDIV
TVKAMQLSVSNGLESQHNSWDGSYFHTARIAAKKAYKEAGIDNPREEVSMMEVHDCFSIT
ELVTMEDLFISPEGGAVKDVMDGFYDADGKVPCQIDGGLKCFGHPIGASGLRMAYEMYLQ
LQGRAGERQLANPKIGLTHNLGGAPSQNVCSVTIIGAQGA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggtatcaaggacaaggtcgcgatcctcggcatgggttgctcgaaattcggc
gaacgctgggatgcaggccctgaggaactgatggtcgaggcctatctcgaagccatgcag
gacgccggcatcgaaccgacgcagctcgacgcggcctggttttcgacgcatatcgacgaa
atcggcaccggcaagggcggcacgccgctttcggtcgcgctcaggcttccgaacatcgcg
gtaacgcgcgtggaaaacttctgtgcctcaggctcggaagccttccgcggtgccgtttac
gcggtcgcctcgggagctgccgatattgcgctcgcggtcggcgtcgagaagctcaaggac
acaggctatggcggcttgccggtcggcaacatggggacgctcaatccgcagtggtcgccg
tcgggttccgcacccggcaacttcgcgcagcttgcttccgcctaccgggcgaagcatggc
gtcagcaaggaagacctcaagcgcgcgatcgcgcatgtttccgtgaagagccatgccaat
ggcgcgaagaacccgaaggctcatctccgcaatgaggtgacggaagatcaggtgatgaac
gccccgatgatcgccgaaccgttgggcctcttcgattgctgcggcgtgtccgacggtgcg
gcagcggtgatcgttaccacgccggaaatcgccaaggccatgggcaagaaggacatcgtc
accgtgaaggcgatgcagctttcggtctcgaacggcctcgaatcccagcacaacagctgg
gatggcagctatttccacacggcgcggatcgcggccaagaaggcctacaaggaggccggc
atcgacaatccgcgcgaggaagtcagcatgatggaggtgcatgactgcttctccatcacc
gaacttgttacaatggaagatctttttatctcgccggaaggtggggccgtgaaggacgtc
atggacgggttctacgatgccgatggcaaggtcccgtgccagatcgatggcggcctgaaa
tgcttcgggcatcccatcggggcatccggcctgcgcatggcctatgagatgtatctccag
cttcagggccgggcaggcgagcggcagcttgccaatccgaagattggattgacgcacaat
ctgggcggggccccctcccagaatgtctgttcggtgacgattatcggcgcgcaaggcgcg
tga

DBGET integrated database retrieval system