KEGG   Parvibaculum lavamentivorans: Plav_3166Help
Entry
Plav_3166         CDS       T00580                                 

Definition
(RefSeq) Triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plav_3166
   01230 Biosynthesis of amino acids
    Plav_3166
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plav_3166
   00051 Fructose and mannose metabolism
    Plav_3166
   00562 Inositol phosphate metabolism
    Plav_3166
Enzymes [BR:pla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Plav_3166
Exosome [BR:pla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Plav_3166
  Exosomal proteins of bladder cancer cells
   Plav_3166
  Exosomal proteins of melanoma cells
   Plav_3166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3377858..3378610)
Genome map
AA seq 250 aa AA seqDB search
MARVKALVAGNWKMNGLKASKKELTALAKKLGKEKPGCDVLICPPATLIATLKDAAKGTK
IAIGGQDCHAKESGAHTGDVSAEMLKDAGASYVIVGHSERRADHGETDADVKAKAEAAHR
AGLVAIVCVGETEAQRDAGETLKIIKGQLKGSLPAGATAKTTVIAYEPVWAIGTGRTPTA
DDVAKVHAAIRKALDARFGAEGAKMRILYGGSVKPSNAAELMAVPNVNGALVGGASLKAE
DFWGIVSAYA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgtcaaggcgctggtggcgggcaactggaagatgaacgggctgaaggcctcg
aagaaggaactgaccgcgctcgcgaaaaagctcggcaaggaaaagcctggctgcgacgtg
ctgatctgcccgccggcgacattgatcgccacgctgaaggacgcagcgaagggcaccaag
atcgccattggcggccaggactgccatgcgaaggagagcggcgcccataccggcgatgtg
tcggcggagatgctgaaggatgcgggtgcgtcctatgtcatcgtcggccattcggagcgc
cgcgccgatcatggcgagacggacgcggatgtgaaggcgaaggcggaagccgcgcaccgc
gccgggctcgtcgcgatcgtgtgtgtgggcgagacggaagcgcagcgcgacgcgggcgag
acgctgaaaatcatcaagggccagctcaagggctcgcttcccgccggtgcgacggcgaag
acgaccgtcatcgcctatgagccggtctgggcgatcggcaccggccgcacgccgacggcg
gacgacgtggccaaggtccatgccgcaatccgcaaggcgctcgacgcccgcttcggcgcg
gaaggcgcgaagatgcgcattctctatggcggctcggtgaagccctcgaacgcggccgaa
ttgatggcggtgccgaacgtcaacggcgcgctggtcggcggcgcgagcctcaaggcggag
gatttctgggggatcgtctctgcctacgcctga

DBGET integrated database retrieval system