KEGG   Parvibaculum lavamentivorans: Plav_3254Help
Entry
Plav_3254         CDS       T00580                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pla  Parvibaculum lavamentivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3477067..3478122
Genome map
AA seq 351 aa AA seqDB search
MQSEDLEFASEWSATALQLMAAHGIPPSPENYSIWFRYVSGKLPELNKEIDACIESGHTI
DIEVTAALQDRFFSDGKLADVTLSTGAKLNTEVNQILKIIEETVGNSTALGTTVREASEG
LTNQSTPNDVRRAVEAIVTASRKMEDRSVELEEHLQATKKELDELQQNLEKAHTEARTDG
LTGVNNRKAFDEALARAMAAASTSNAPLCLAIGDIDHFKKFNDTFGHRTGDQVLRLVANC
LKTGALEQHFVARYGGEEFAVIMPATDIATAEAISNKIRETVQARELVKRSTGESLGRVT
MSMGIALLRDTDSAASLIERADGCLYDAKHAGRNRIITECHGLEMSHAKAS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcgaggacttggaatttgcttcggaatggagtgctacggcgctccagttgatg
gcggctcacggtatcccgccgtctcccgaaaattattccatctggttccgctatgtctcc
ggcaagctaccggaattgaacaaggaaatcgacgcctgcattgagagtggccataccatc
gacatcgaggtaaccgctgcgctgcaagaccggttcttttccgacggcaaactcgctgat
gtgacgctcagtaccggtgccaaactcaataccgaagtcaatcagatcctaaaaatcatc
gaggagacagtcggcaactctaccgctctcggcaccaccgtgcgcgaggcgagcgaaggg
ctgaccaaccagtcgacaccgaacgacgttcgtcgcgcggtcgaggccattgttactgcc
tcgcggaaaatggaagatcgtagcgtcgaactcgaagagcacctgcaggctacaaaaaaa
gaactcgatgaattgcagcagaacctcgagaaagctcatacggaggcacgaaccgacggc
ttgaccggcgtcaacaatcgaaaggctttcgacgaggcgctagcccgcgcgatggcggcg
gcttcaacaagcaatgcccctttgtgcctcgctatcggcgatatcgaccatttcaaaaag
ttcaacgacacgttcgggcatcggactggcgaccaggttctgcggctcgtagcgaactgc
ttgaagacaggcgctttggagcagcattttgttgcccgctacggcggtgaagagtttgcc
gtcatcatgcctgctaccgatatcgcaacggccgaagccatttccaacaaaattcgcgag
acggtgcaggccagggaactcgtgaagcgctcgacgggagagtctctcggccgcgttacc
atgtcgatgggtattgcactcctgagggataccgacagcgccgcttcactgatcgaacga
gcggacggttgcctttacgatgccaaacacgctggccggaatcggatcatcaccgaatgt
cacggcttggaaatgtcacacgccaaagccagctag

DBGET integrated database retrieval system