KEGG   Parvibaculum lavamentivorans: Plav_3336Help
Entry
Plav_3336         CDS       T00580                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00230  Purine metabolism
pla00240  Pyrimidine metabolism
pla01100  Metabolic pathways
pla03030  DNA replication
pla03430  Mismatch repair
pla03440  Homologous recombination
Module
pla_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Plav_3336
   00240 Pyrimidine metabolism
    Plav_3336
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Plav_3336
   03430 Mismatch repair
    Plav_3336
   03440 Homologous recombination
    Plav_3336
Enzymes [BR:pla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Plav_3336
DNA replication proteins [BR:pla03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Plav_3336
DNA repair and recombination proteins [BR:pla03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Plav_3336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABS64940
JGI: Plav3336
UniProt: A7HYF7
Position
complement(3572950..3573399)
Genome map
AA seq 149 aa AA seqDB search
MTEVLFYHLQNAPLEQVLPQLLERSLERGWRAIVRAGGPERLDALNNVLWTYSDDSFLPH
GTLDDGPAALEPVFLTVDDENPNNANVLFLVDGAAPGNIGPYERCVLMFDGRDEAALAAA
REHWKTLKAEGHDATYWQQSPEGRWEKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaggttctgttctaccatttgcagaacgcgcctctggaacaggtgctgccgcaa
ttgctggagcgttcgctggagcgcggctggcgcgcgattgtcagggctggcggtccggag
cggctcgacgcgctcaacaatgtcctctggacctacagcgacgacagctttctgccgcac
ggaacgctggatgacggccccgccgcgctggagcccgtctttctgaccgtcgatgacgaa
aacccgaacaacgccaacgtcctcttccttgtcgatggcgctgcccccggcaatatcggc
ccctatgagcgctgcgtgctgatgttcgacggccgcgacgaagcggcgctcgccgccgcg
cgcgaacactggaaaacgctgaaggcggaagggcacgacgccacctattggcagcaaagc
ccggaaggccggtgggaaaagaaggcgtga

DBGET integrated database retrieval system