KEGG   Parvibaculum lavamentivorans: Plav_3461Help
Entry
Plav_3461         CDS       T00580                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pla  Parvibaculum lavamentivorans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Plav_3461
Enzymes [BR:pla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Plav_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3705111..3706628
Genome map
AA seq 505 aa AA seqDB search
MSARITPQTPALQALRMRLHAQHQPVVLMRTDCHVCRAEGLAPRSQVLIIAGDRTVQALL
YQIDSDLLKTGQIALSEAAWDALDIHEGDLVQVRHPPLLESLSAVRARIHGHRLQTTELQ
AIVRDVVDGRYTDVALSAFLTATAVLPLDMQETIHLTRAMVDVGDHLQWQAPIVVDKHCV
GGLPGNRTTPLVVAIAAANGLVMPKTSSRAITSPAGTADTMETLAPVDLDLDTLRKVVEK
EGGCVAWGGAMHLSPADDIFVRIERELDIDTQGQLIASVLSKKIAAGATHIVIDIPVGPT
AKVRSRETAEHLAHHLSEVAASFGLVLRCLFTDGNQPVGRGIGPALEARDVLAVLRNEAD
APQDLCDRVALVAGAVLELGGVAKEGDGIRLAHETISSGRAWEKFQRICAAQGGFREPPQ
ALYVEPLLATTSGRAVHIDNRKLSRLAKLAGAPESPAAGIQLQVRLGDEVTRGQSLMFLH
AQTSGEMAYALAYVHDIGDIVKIEP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcccgcatcactccccagacacccgccttgcaagcattgcgcatgcgactgcat
gcccagcatcaacccgtcgtcttgatgcgtaccgattgccatgtctgccgtgccgaaggg
ctggcaccgcggtcacaggtactgatcattgccggcgaccgcactgtgcaagcgctactg
taccaaatcgacagcgatctgctcaaaaccggacagatcgctctgtccgaggccgcctgg
gatgccctggacattcatgagggcgatcttgtgcaggttcggcatcctccgctgctcgaa
tcgttgtcggccgtgcgtgcgcgaattcacggccaccgactgcaaacgacggagttgcag
gcgatcgtccgtgatgtggtcgatggtcgctataccgatgtcgcactttcggccttcctg
accgcaacggcggtactgcctctggatatgcaagagaccatccatctcacccgtgcgatg
gtcgatgtcggagatcacctgcaatggcaggctccgattgttgtggacaagcattgcgtg
ggcggattaccgggaaatcgcaccacgccgttggtggttgccatcgccgcagccaatgga
ttggtgatgcccaagacctcatcacgcgccatcacctctcccgctggcaccgcggacacc
atggaaacgctggctcctgtagacctggacctggatacgctcagaaaggtcgtggagaaa
gagggtggatgcgtggcgtggggcggcgcgatgcacctcagccccgcggacgacatcttc
gtgcgtattgagcgtgaactggatatcgacacgcaaggacaactgattgcctcggtgtta
tccaagaagattgcagcaggggcgacccacatcgtgatcgatattccggttgggccaacc
gcaaaagtccgcagccgggaaactgccgagcatcttgcgcatcacctttcggaagtcgcc
gcgtcatttggccttgtattgcgttgcctgtttacagacgggaatcagcctgtcggcaga
ggtatcggcccggcgttggaggcgcgcgacgtgttggccgtattgcgcaacgaggcggat
gcgccgcaagacctatgtgaccgcgtggcgttggtcgcgggtgcggtacttgagcttggc
ggcgtcgccaaagaaggggatggaattcgattggctcacgagacgatcagcagtggccgc
gcctgggaaaaatttcagaggatctgtgccgctcaggggggatttcgtgagccaccccaa
gctctttacgtcgaaccgcttttggcaaccacttcaggccgagcagtacacatcgacaac
cgtaagctgtcccgtttagccaaattagccggagcgcctgagagtccagccgcagggatt
caattgcaagtgcgcttaggtgacgaggtaacacgcggacaatcattgatgtttttgcat
gcgcaaacctctggagagatggcctatgcactcgcatacgtgcatgacattggtgacatc
gtaaagattgaaccttag

DBGET integrated database retrieval system