KEGG   Candidatus Portiera aleyrodidarum BT-B: B186_124Help
Entry
B186_124          CDS       T02206                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ple  Candidatus Portiera aleyrodidarum BT-B
Pathway
ple00020  Citrate cycle (TCA cycle)
ple00310  Lysine degradation
ple01100  Metabolic pathways
ple01110  Biosynthesis of secondary metabolites
ple01120  Microbial metabolism in diverse environments
ple01130  Biosynthesis of antibiotics
ple01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ple00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B186_124 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    B186_124 (sucB)
Enzymes [BR:ple01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B186_124 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh DUF979
Motif
Other DBs
NCBI-ProteinID: AFQ24086
Position
138669..139745
Genome map
AA seq 358 aa AA seqDB search
MLEVVSPTEGFLQIIKIPVGKKCKSEQLLGIIVAQKEEGFYSSGSSSTSTNIKQQKLCKK
EQKVDESEKQELKQFYKQAIELEESYSPEVRKAKTSIDVENLFENGTVQDKRVNIRKENV
KYSINEIGVKRVQLSRLRQTITKRIVKAQKNAAMLTTYNEVDMGNILEIRTKYRELFEKK
HGTKLGLMGFFVKACTVALKQFKKVNAVIDDKEIVYHNYQDIGIAVSTNRGLVVPILRHT
DSIKIEEIEKKIMDFRKRGVDGKLSIKELTGGTFTISNGGVFGSLFSTPIINPPQTAILG
MHKIQNRPVVLKGEIVIRPMMYLALSYDHRLIDGKDAVNFLFFVKELLEQPIRFILNI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaggttgtttcaccaactgaagggtttcttcaaattataaagataccagtaggt
aaaaaatgcaaatccgagcaattgttaggtattattgtagcacaaaaagaagaaggtttt
tatagttcaggttcatcaagcacaagcacaaacatcaaacagcaaaaattgtgtaaaaaa
gagcaaaaggtagatgaatcagaaaaacaagaattaaaacagttttataaacaagcaata
gaattagaagaaagttattcaccagaggtacgtaaggctaagactagtatagatgttgaa
aacttatttgagaatggcacagtacaagataaaagggtaaatattagaaaagaaaatgtt
aaatatagtattaatgaaattggagttaaaagagtacaattaagtcgtttacgtcagacg
attactaaacgtatcgtgaaagctcaaaaaaatgctgcaatgttaactacttataatgaa
gtagatatgggtaatatattagaaatacgcacaaaatatcgagaactatttgaaaagaaa
catggaactaagctagggttaatgggattttttgtaaaagcttgtacggtggcgctaaaa
cagttcaaaaaagtaaatgcagttattgatgataaagaaattgtttatcataattatcaa
gacataggaatagcagtttctacaaataggggtttagttgttcctattttaaggcatact
gattctataaaaatagaagaaatagaaaaaaaaattatggattttaggaaacgtggtgtt
gatggaaaattaagtattaaagaattaactggtggaacttttacgataagtaatggagga
gtttttggatctctgttttctactcctattattaatccccctcaaactgctattttggga
atgcataaaattcaaaaccgtcctgtagttttaaaaggagaaatagttatacggcctatg
atgtatttagccttgtcgtatgatcatcgtcttattgatggaaaagatgcagttaatttt
ttattttttgttaaggagcttttagaacaacccattcgttttatattaaacatttaa

DBGET integrated database retrieval system