KEGG   Candidatus Portiera aleyrodidarum BT-B: B186_150Help
Entry
B186_150          CDS       T02206                                 

Gene name
aceF
Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ple  Candidatus Portiera aleyrodidarum BT-B
Pathway
ple00010  Glycolysis / Gluconeogenesis
ple00020  Citrate cycle (TCA cycle)
ple00620  Pyruvate metabolism
ple01100  Metabolic pathways
ple01110  Biosynthesis of secondary metabolites
ple01120  Microbial metabolism in diverse environments
ple01130  Biosynthesis of antibiotics
ple01200  Carbon metabolism
Module
ple_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ple00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B186_150 (aceF)
   00020 Citrate cycle (TCA cycle)
    B186_150 (aceF)
   00620 Pyruvate metabolism
    B186_150 (aceF)
Enzymes [BR:ple01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B186_150 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF1725
Motif
Other DBs
NCBI-ProteinID: AFQ24108
Position
complement(165239..166351)
Genome map
AA seq 370 aa AA seqDB search
MIIKLPEIGDINKKVEVIEIPVKVGEFIKKDDTIVVLESEKATIDLPSPNEGTITKILIK
EGENIYSGKSIMELEDIINKKVILNKEKSIAQAGPAAKLMARKLGIDLETDKIIGSGKKN
CILKEDLKSYIKDKRIESSEDNTDQNVKNILSVSAKKLHNSWRNIPHVTHFDELDITKVE
KFRKTIKYELGIKITLLSFFIKVCSCALQKFSKFNMLLDLKTNKRNFHKSSHNNISIAIN
TSKGLLVPVIKHVDKKNIIDIALELKEITKRTLIGKNKLDDMMGGCFTISNLGIIGGKGF
TPIINSPEIGILGIGKTNIKPIWTGKQFKPTTMLPICLSYDHRFINGVYAAKFIKFIIKL
LTDIRNWIVC
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgataataaagctacctgaaataggtgatataaataaaaaagttgaagttatagaaata
cccgtaaaagtaggagaatttataaaaaaagatgacactatagttgttttagagtcagaa
aaagctactattgatttaccttcaccaaacgaaggaacaataactaaaattttaattaaa
gaaggtgaaaacatatattcgggtaagtcaataatggaattagaagacattataaacaaa
aaagttattttaaataaagaaaaaagtattgcacaggcgggtcctgctgcaaaattaatg
gcaagaaaattaggtattgatttagaaacagacaaaataatcggaagtggaaagaaaaat
tgtattttaaaagaagatttaaaaagttatataaaagataagagaatagagagttcagaa
gacaacactgatcaaaacgtaaagaatatattaagtgtaagtgctaaaaagttacataat
agttggagaaatatacctcatgtaactcattttgatgaattagatataacaaaagtagaa
aagtttagaaaaacaataaaatatgaattaggtattaaaataacattattatcttttttt
ataaaagtatgttcttgtgcattacaaaaattttctaagtttaatatgttgttggattta
aaaacaaataaacgtaattttcacaaatcaagccataataacattagcattgctataaat
acatcaaaaggtttgttagtgcccgtaataaaacatgttgataaaaaaaatatcattgat
attgctttagaattaaaagaaataactaaaagaacattaataggtaaaaataaactagat
gatatgatgggtggctgttttacaatatctaatttaggaataataggtggtaaaggtttt
actccaatcattaacagtccagaaataggaattttaggcattggcaaaacaaacattaaa
cctatttggactggtaaacaatttaaaccaacaacaatgttaccaatttgtctctcgtat
gatcatagatttataaatggcgtttatgcagcaaagtttattaaatttataattaagtta
ttaactgatattcgtaattggattgtttgttaa

DBGET integrated database retrieval system