KEGG   Candidatus Portiera aleyrodidarum BT-B: B186_150Help
Entry
B186_150          CDS       T02206                                 

Gene name
aceF
Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ple  Candidatus Portiera aleyrodidarum BT-B
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ple00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B186_150 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B186_150 (aceF)
   00020 Citrate cycle (TCA cycle)
    B186_150 (aceF)
   00620 Pyruvate metabolism
    B186_150 (aceF)
Enzymes [BR:ple01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B186_150 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(165239..166351)
Genome map
AA seq 370 aa AA seqDB search
MIIKLPEIGDINKKVEVIEIPVKVGEFIKKDDTIVVLESEKATIDLPSPNEGTITKILIK
EGENIYSGKSIMELEDIINKKVILNKEKSIAQAGPAAKLMARKLGIDLETDKIIGSGKKN
CILKEDLKSYIKDKRIESSEDNTDQNVKNILSVSAKKLHNSWRNIPHVTHFDELDITKVE
KFRKTIKYELGIKITLLSFFIKVCSCALQKFSKFNMLLDLKTNKRNFHKSSHNNISIAIN
TSKGLLVPVIKHVDKKNIIDIALELKEITKRTLIGKNKLDDMMGGCFTISNLGIIGGKGF
TPIINSPEIGILGIGKTNIKPIWTGKQFKPTTMLPICLSYDHRFINGVYAAKFIKFIIKL
LTDIRNWIVC
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgataataaagctacctgaaataggtgatataaataaaaaagttgaagttatagaaata
cccgtaaaagtaggagaatttataaaaaaagatgacactatagttgttttagagtcagaa
aaagctactattgatttaccttcaccaaacgaaggaacaataactaaaattttaattaaa
gaaggtgaaaacatatattcgggtaagtcaataatggaattagaagacattataaacaaa
aaagttattttaaataaagaaaaaagtattgcacaggcgggtcctgctgcaaaattaatg
gcaagaaaattaggtattgatttagaaacagacaaaataatcggaagtggaaagaaaaat
tgtattttaaaagaagatttaaaaagttatataaaagataagagaatagagagttcagaa
gacaacactgatcaaaacgtaaagaatatattaagtgtaagtgctaaaaagttacataat
agttggagaaatatacctcatgtaactcattttgatgaattagatataacaaaagtagaa
aagtttagaaaaacaataaaatatgaattaggtattaaaataacattattatcttttttt
ataaaagtatgttcttgtgcattacaaaaattttctaagtttaatatgttgttggattta
aaaacaaataaacgtaattttcacaaatcaagccataataacattagcattgctataaat
acatcaaaaggtttgttagtgcccgtaataaaacatgttgataaaaaaaatatcattgat
attgctttagaattaaaagaaataactaaaagaacattaataggtaaaaataaactagat
gatatgatgggtggctgttttacaatatctaatttaggaataataggtggtaaaggtttt
actccaatcattaacagtccagaaataggaattttaggcattggcaaaacaaacattaaa
cctatttggactggtaaacaatttaaaccaacaacaatgttaccaatttgtctctcgtat
gatcatagatttataaatggcgtttatgcagcaaagtttattaaatttataattaagtta
ttaactgatattcgtaattggattgtttgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system