KEGG   Candidatus Portiera aleyrodidarum BT-B: B186_184Help
Entry
B186_184          CDS       T02206                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ple  Candidatus Portiera aleyrodidarum BT-B
Pathway
ple00300  Lysine biosynthesis
ple01100  Metabolic pathways
ple01120  Microbial metabolism in diverse environments
ple01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ple00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    B186_184 (dapE)
Enzymes [BR:ple01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     B186_184 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFQ24141
Position
217008..218162
Genome map
AA seq 384 aa AA seqDB search
MYYLLKLVLNLLSKNSITPNDKGCQYLLSNIFKRLCFRVEVFNKKGVHNLWVTNGFCKKT
LLFVGHTDVVPSGPIKAWEINPFLPYLNNRGYIISRGIVDMKGSLCSMIKATCNFIKLYP
KSKEKIAFLITSDEEGDGNYGTKYVINKLIKRNEIINYCIIGEPTSKSNTGDTLKIGRRG
SLNAKIIIYGIQGHIAYTKQLLNPIHILINIIHYLLKIRWDKGNKYFSKTSFQISNFIAG
LGVSNMLPKYAKVLCNFRFSNELTVNKIKTKVSNIFLLFNLNKKKDFKINWYLSGEPYLT
KKGTLLNAVIFGINYMCKIQPKKNTNGGISDGRFVKNLCKQIIELGLINATIHKINECVC
VSDIILLTKLYQLIIEYLFIYKFK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtattatcttttaaaactagtattaaatttactttcaaaaaactctattacacctaat
gacaaaggatgtcaatatttgcttagtaatatatttaaacgtttatgttttcgtgtagaa
gtttttaataaaaaaggagttcataatttatgggttacaaacggattttgtaaaaaaaca
ttgttatttgttggtcatacagatgtagttccttcaggcccaattaaagcatgggaaatt
aacccgtttttaccttatttaaataatagaggatatattatatcacgtggaattgtcgat
atgaaaggtagtttatgttcaatgataaaagcaacatgtaattttataaaattatatcca
aaatctaaagagaaaatagcttttttaataacaagtgatgaagaaggtgatggaaattat
ggtactaaatatgttataaataagttaataaaaagaaatgaaataataaattattgtatt
atcggtgagcctactagtaaatcaaatacaggtgatactcttaaaataggtagacgaggt
tcattaaatgccaaaataataatatacggtattcaaggacatatagcgtatacaaaacaa
ttgctaaatccaatacatatattaattaatataatacattatttattaaaaattagatgg
gataaaggtaataaatatttttctaaaaccagttttcaaatatccaacttcattgcagga
ttaggtgtaagtaatatgttacctaaatacgcaaaagtattatgtaattttagattttca
aatgaacttacagttaataaaattaaaaccaaagtaagtaacatatttttactgtttaat
ttaaacaaaaaaaaagattttaaaatcaattggtatctatctggagaaccatacctaaca
aaaaaaggtactttgttaaatgctgtaatttttggaattaattatatgtgcaaaatacaa
ccaaaaaaaaatacaaatggtggcatatcagatggtagatttgtcaaaaatctttgtaaa
caaataattgagttaggcttaataaatgccactatacataaaataaatgaatgtgtttgc
gtttctgatattatactattaacaaaactgtatcaacttatcattgaatatttgtttatt
tataaatttaaataa

DBGET integrated database retrieval system