KEGG   Candidatus Portiera aleyrodidarum BT-B: B186_212Help
Entry
B186_212          CDS       T02206                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ple  Candidatus Portiera aleyrodidarum BT-B
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ple01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ple00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ple00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(254379..255350)
Genome map
AA seq 323 aa AA seqDB search
MNHLALVGDIGGTNVRLALALVSTNQLKLYKIKIFKCINYLNVYEVIKQYISLVGCDYPK
QACLAFACPVYSNFIKMTNNSWTIAKYELKHKLNLQKLKIINDFTAIALGLTHIQAKDLY
KLGYGKTNNNSNKILIGPGTGLGIAGLIHTKNSWIPFSGEGGHISFAPIDNFEVYILNWF
QNNYKRVSIERILCGQGIVDLYYAHVNYYINHSYNVLTTPDAITKAALKKNDPLAYKTIL
MFCKLLGHVTGDMALTLGAKGGVYLCGGILPRIIKILDNSDFRNSFDNKGRMSFYNKEIS
TWLVKSKWIGLLGSADALFNNKL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttagcattagtaggtgatataggcggaacgaatgttcgtttagctttagct
ttagtatcaacaaatcaattaaaattatataaaataaaaatatttaaatgtattaattat
ctaaatgtttatgaagttataaaacaatatatttctttagttggttgtgattatcctaaa
caagcttgtttagcgtttgcttgtcctgtttactctaattttataaaaatgacaaataat
tcttggacaatagcaaaatatgaattaaaacataaactgaacttacaaaagttaaaaata
atcaacgattttactgcgatagccttagggttgactcatattcaagcaaaagatttgtat
aaacttggatacggaaaaactaataataatagtaataaaattttaataggacctggaact
ggattaggaattgccggtttaattcatactaaaaattcatggatcccattttctggggaa
gggggtcatatcagttttgcgccaattgataactttgaagtatatattttaaattggttt
caaaataattataagcgtgtttctattgaacgcatactttgtggacaaggaatagtagat
ttatattatgcacatgttaattattatattaaccactcttataatgttttaacaacgcct
gatgccattacaaaagcagctttaaaaaaaaacgatcctttagcatataaaactattttg
atgttttgtaaactattaggtcatgtaacaggtgatatggcgttaactttaggagctaaa
ggaggagtgtatttatgtggaggaatattacctagaatcataaaaatcttagataatagt
gattttcgtaattcttttgacaataaaggaagaatgagtttttataataaagaaatttca
acttggttagttaaatctaaatggataggtttattagggtcagctgatgctttgtttaat
aacaaactttaa

DBGET integrated database retrieval system