KEGG   Candidatus Portiera aleyrodidarum BT-B: B186_294Help
Entry
B186_294          CDS       T02206                                 

Gene name
thrC
Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ple  Candidatus Portiera aleyrodidarum BT-B
Pathway
ple00260  Glycine, serine and threonine metabolism
ple01100  Metabolic pathways
ple01110  Biosynthesis of secondary metabolites
ple01120  Microbial metabolism in diverse environments
ple01230  Biosynthesis of amino acids
Module
ple_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ple00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B186_294 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B186_294 (thrC)
Enzymes [BR:ple01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B186_294 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF2929
Motif
Other DBs
NCBI-ProteinID: AFQ24228
Position
351445..352830
Genome map
AA seq 461 aa AA seqDB search
MRYVSTRGVAPVLSFEDTVLTGLASDGGLYVPEIIPKLSHKEFIELSKCSYIESAYRIMR
LFIDDVDDMSLKLLIKKSYTRFCNDSIVPIKQIGNNQFLLDLFTGPTFAFKDIALQFMGN
LIDYFLKKRGEKAVIMGATSGDTGSAAIAGFCDCNNLDMFILHPNKMVSEIQRRQMTTVK
QDNIHNIALKGNFDDAQAIVKDSFNNRGFIKGRRLIAINSINWARILAQTVYYIVSALAV
GAPFRNVSFTVPSANFGNIFAGYIAYKMGLPIRQLIIATNVNNILHRIIEYNDFSIRNLV
NTIAPAMDIVVSSNFERLLFYAYNKDSNAINNLIYNFNNKNYTILDEKPLKKLRTLFYST
SVNDNTILSILSQFYNRNGFIVDPHTAIGLIAAERCNNFPEIPMITLATAHPAKFYDTIL
KSGLFLKLPSLLNELLLKEEQYSILPADISKVHSYILSVCH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgttagtactcgcggtgttgctcctgtactttcatttgaagatacagtattg
actggtttagcaagtgatggtggtttatatgttccagaaataattcctaaactttcgcat
aaagaatttatcgaattaagtaagtgttcatatattgaatcagcatatcgtataatgcgt
ctttttattgatgatgttgatgatatgtccttaaaacttttaattaaaaaaagctataca
aggttttgtaatgattcaatagttccaataaaacaaataggtaacaatcaatttttattg
gacttgtttactggtcctacatttgcttttaaggatatagctttacaatttatgggtaat
ttaatagattattttttaaaaaaacgtggcgaaaaagctgttattatgggtgcaacgtca
ggagatacaggatcagctgctattgctggtttttgtgattgtaataatttagacatgttt
attttacacccaaataaaatggtatcagaaattcaaagaagacaaatgactacagttaaa
caagataatatacataatatagctttaaaaggaaattttgatgatgcgcaggcaatagtt
aaagatagttttaataatcgtggctttattaaaggaagaaggttaattgctataaactca
ataaattgggcacgtattttagcacaaacagtatattatattgtttcagcacttgcagta
ggtgctccttttaggaatgtaagttttaccgtaccgtcagcaaattttggaaatattttt
gcaggatatatagcttataaaatgggcttgccaattaggcaactaataattgcaacaaat
gttaataatatacttcatcgtattatagaatataatgatttttctataagaaatttagtt
aatactatagcgccagctatggatatagttgtttcttctaattttgaacggttgttgttt
tatgcttataataaagattcaaatgctattaacaatttgatttataactttaataataaa
aattacactatactagacgaaaaacctttgaagaaattaagaactttgttttatagtacg
agtgtaaatgataacactattttgtctatactaagtcagttttataaccgtaatggtttt
atagtagaccctcacacagctataggtttaattgctgccgaaagatgtaataattttcca
gaaatacccatgattacgttagctacagctcatccagctaaattttatgataccatttta
aaatctggactttttcttaaattaccttctttacttaacgaattattactaaaagaagaa
caatattctattttgcctgcagatatttcaaaagtgcacagttatatattaagtgtttgt
cattaa

DBGET integrated database retrieval system