KEGG   Pantoea ananatis LMG 5342: PANA5342_0029Help
Entry
PANA5342_0029     CDS       T01728                                 

Gene name
bglA1
Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:plf00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28943..30325
Genome map
AA seq 460 aa AA seqDB search
MNYRFPENFWWGSASSALQAEGDSLNGGKSPTTWDRWFAQQPHRFHQGIGPQDTSGFYQH
WQHDIALLKQLGHNSFRTSLSWARLMPDGTDAVNPDAVTFYNKVIDALLAQGITPFITLF
HFDMPLAMQDKGGWENREVVEAFGRYAQRCFALFGHKVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFRRAANVALHTVLAHALAVRAWRNGGYDGDIGVVLNLTPSYPRSANPADVQAAH
HADLLFNRSFLDPVLKGEYPVDLLSLLSQYHQLPRCQPGDAALIADGIIDLLGVNYYQPR
RMKCRDSAVNAEAPFMPEWLFDHYEMPGRQMNPYRGWEIYAPGIYDILTNLRVNYGNPRC
FISENGMGVENEQRFIQNGEILDDYRIEFVSEHLKWLHKGIREGCHCLGYHMWTFIDNWS
WLNGYKNRYGFVQLDLATQKRTIKKSGKWFAEVAENNGFN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccgttttcctgaaaatttctggtggggcagcgccagctcggcgttacaagcc
gaaggggacagcctgaatggcggtaaaagccctaccacctgggatcgctggtttgcacaa
cagcctcaccgtttccatcaaggcattggcccacaagacacctcgggcttttatcagcac
tggcagcacgatatcgcattactaaagcagttagggcacaacagctttcgcacgtcgctg
agctgggcgcgcctgatgccagacggcactgacgccgtgaatcctgacgccgtgactttt
tataacaaggtcatcgatgcattactggcgcagggcattacaccgtttatcaccctgttt
cattttgatatgcctctggctatgcaggacaaaggcggctgggagaaccgtgaggttgtg
gaggcgtttggccgctatgcccagcgctgtttcgcgctgttcggccataaggtgaaacac
tggtttaccttcaatgaaccgattgtgccggtcgaaggtggctatctgtacgattttcat
tatcccaacgttgtggacttcagacgagcggctaacgtggccttgcacacagtcctggca
cacgcgctggcagtacgcgcctggcgtaacggcggctacgacggtgacattggtgtggtg
ctgaacctcacgccgtcctatccacgatcggcgaatccggccgatgtgcaagccgcacat
catgctgacctgttgtttaaccgcagctttctggatccggttctgaagggagaatatccc
gtggatctgctgagcttactgagtcagtaccaccagcttccgcgctgccagcctggcgac
gctgcgttgattgccgacggcattatcgaccttctgggcgtgaactattatcagccgcgc
cggatgaagtgtcgggacagcgccgtcaatgctgaagcgccctttatgccggagtggtta
ttcgaccactatgaaatgccaggccgtcagatgaatccgtatcgtggatgggaaatttac
gcgcccggtatttacgatattctgactaacctgcgggttaattatggaaacccgcgctgt
tttatttctgaaaatggtatgggcgttgagaatgaacagcgatttattcagaacggtgaa
attctggatgattatcgtatcgaatttgtttccgaacatcttaaatggctgcataaaggg
attcgcgaaggctgtcattgcctgggttatcatatgtggacatttattgataactggtca
tggctaaacggttataaaaatcgttacggttttgtgcagttagatttagccacgcaaaaa
cgtacgattaaaaagagtggcaaatggtttgctgaggttgccgaaaataacggttttaat
tga

DBGET integrated database retrieval system